BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_I09 (654 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ130976-1|CAA10274.1| 463|Homo sapiens Ariadne protein (ARI) p... 33 1.2 >AJ130976-1|CAA10274.1| 463|Homo sapiens Ariadne protein (ARI) protein. Length = 463 Score = 32.7 bits (71), Expect = 1.2 Identities = 21/71 (29%), Positives = 30/71 (42%), Gaps = 3/71 (4%) Frame = +3 Query: 300 LIYPHQYPVSLSLHHKSTWSCXKEKVT---FXNGIHVDISCCSSAFNVCFDGYYINFKIW 470 L YP+ Y L HK C E +T G+ ISC + N+ D + I Sbjct: 97 LNYPNSYFTGLECGHKFCMQCWSEYLTTKIMEEGMGQTISCPAHGCNILVDDNTVMRLIT 156 Query: 471 SSVVQIKAHHI 503 S V++K H+ Sbjct: 157 DSKVKLKYQHL 167 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 82,560,847 Number of Sequences: 237096 Number of extensions: 1442758 Number of successful extensions: 6801 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 6725 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6801 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7310122300 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -