BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_I04 (479 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0507 + 3655570-3655573,3655648-3655832 90 1e-18 04_04_0165 + 23247265-23247472,23248115-23248407,23249182-232492... 34 0.052 06_01_0520 + 3761990-3762327,3763304-3763589,3763746-3763820,376... 32 0.28 02_02_0664 - 12747888-12747900,12748161-12748229,12748332-127483... 30 1.1 >06_01_0507 + 3655570-3655573,3655648-3655832 Length = 62 Score = 89.8 bits (213), Expect = 1e-18 Identities = 41/59 (69%), Positives = 47/59 (79%) Frame = +3 Query: 252 GKVHGSLARAGKVKGQTPKVEKQQKKXXXTGRAXRXIQYNRRFVNVVQTFGRRRGPNSN 428 GKVHGSLARAGKV+GQTPKV KQ KK GRA + +QYNRRFV V FG++RGPNS+ Sbjct: 2 GKVHGSLARAGKVRGQTPKVAKQDKKKKPRGRAHKRMQYNRRFVTAVVGFGKKRGPNSS 60 >04_04_0165 + 23247265-23247472,23248115-23248407,23249182-23249239, 23249302-23250014 Length = 423 Score = 34.3 bits (75), Expect = 0.052 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +2 Query: 59 RAIDTRPGRQWPGVHWSDQGTHSYSCCSWR*RPYSIIMWS 178 +A+ RP PG+HW++Q YS CS P I MW+ Sbjct: 368 KAMSMRPDAH-PGIHWNNQWMRGYSDCSHWCLPGPIDMWN 406 >06_01_0520 + 3761990-3762327,3763304-3763589,3763746-3763820, 3764013-3764961,3766967-3767064,3768144-3768284, 3768758-3768874,3768924-3769013,3769014-3771818 Length = 1632 Score = 31.9 bits (69), Expect = 0.28 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = -1 Query: 137 SKSTNAFLDLTNGLLAIDVQDVCRLPSDMQLHSC 36 S + N+ LD T+ ++ D Q+V LP D HSC Sbjct: 1455 SANKNSLLDQTSENVSTDHQEVSMLPQDQHYHSC 1488 >02_02_0664 - 12747888-12747900,12748161-12748229,12748332-12748395, 12749540-12749558,12749777-12749843,12749934-12749953, 12750079-12750248,12751646-12751823 Length = 199 Score = 29.9 bits (64), Expect = 1.1 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +2 Query: 83 RQWPGVHWSDQGTHSY 130 R WPG+HWSD T Y Sbjct: 51 RIWPGLHWSDSSTPLY 66 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,442,725 Number of Sequences: 37544 Number of extensions: 194449 Number of successful extensions: 503 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 490 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 503 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 991020332 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -