BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_I01 (653 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27553| Best HMM Match : Pyr_redox (HMM E-Value=1.1e-20) 87 1e-17 SB_4742| Best HMM Match : Glutaredoxin (HMM E-Value=5.6e-19) 82 4e-16 SB_45748| Best HMM Match : Glutaredoxin (HMM E-Value=0.00065) 42 3e-04 SB_45745| Best HMM Match : Glutaredoxin (HMM E-Value=0.00065) 42 3e-04 SB_1233| Best HMM Match : DUF547 (HMM E-Value=0) 42 3e-04 SB_52133| Best HMM Match : Glutaredoxin (HMM E-Value=4.4e-17) 40 0.002 SB_20536| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_31341| Best HMM Match : UDP-g_GGTase (HMM E-Value=0) 31 0.62 SB_43439| Best HMM Match : AhpC-TSA (HMM E-Value=9.80909e-44) 31 1.1 SB_38289| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_17581| Best HMM Match : HHH (HMM E-Value=4.2) 30 1.9 SB_30152| Best HMM Match : Ank (HMM E-Value=1.8e-23) 28 5.8 >SB_27553| Best HMM Match : Pyr_redox (HMM E-Value=1.1e-20) Length = 1037 Score = 87.0 bits (206), Expect = 1e-17 Identities = 42/114 (36%), Positives = 69/114 (60%) Frame = +1 Query: 91 VLSSGKITRSSKMAGSIXIQQFIKEAISKDKVVVFSKSYCPYCKLAKDVFEKVKQPIKVI 270 V+ S + + MA IQ+ I+++I+ + V++FSKS+CP+CK K +FE + + Sbjct: 548 VVLSDRSPEAKVMAPVPQIQRLIEDSINNNAVMIFSKSFCPFCKKVKAIFESINVQYTAM 607 Query: 271 ELNERDDGNTIQDNLAQLTGFRTVPQVFINGNCVGGGSDVKALYESGKLEPMLI 432 EL+ D+G IQ+ L + +G +TVP V+I GN VGG + L E K+ ++I Sbjct: 608 ELDLVDNGPAIQEALLEKSGQKTVPNVYIRGNHVGGSDIITKLQEENKILGLII 661 >SB_4742| Best HMM Match : Glutaredoxin (HMM E-Value=5.6e-19) Length = 111 Score = 81.8 bits (193), Expect = 4e-16 Identities = 39/93 (41%), Positives = 58/93 (62%), Gaps = 1/93 (1%) Frame = +1 Query: 154 FIKEAISKDKVVVFSKSYCPYCKLAKDVFEKVK-QPIKVIELNERDDGNTIQDNLAQLTG 330 F++ + +VVFSK+ C + +AK + V + V EL +R+DG+ IQD L +LTG Sbjct: 9 FVRSVTRSNNIVVFSKTACSFSIMAKKLLRDVGVSEMVVYELEQREDGHFIQDALKELTG 68 Query: 331 FRTVPQVFINGNCVGGGSDVKALYESGKLEPML 429 TVP VF+ G +GGG + LY+SGKL+ +L Sbjct: 69 RGTVPNVFVKGQSIGGGMETAELYQSGKLKQLL 101 >SB_45748| Best HMM Match : Glutaredoxin (HMM E-Value=0.00065) Length = 152 Score = 42.3 bits (95), Expect = 3e-04 Identities = 28/91 (30%), Positives = 45/91 (49%), Gaps = 4/91 (4%) Frame = +1 Query: 157 IKEAISKDKVVVFSKSYC--PYCKLAKDVFEKVKQP--IKVIELNERDDGNTIQDNLAQL 324 I E + KDKVVVF K P C + V + ++ K N DD ++ + + Sbjct: 41 IGETVKKDKVVVFMKGVPSQPMCGFSNAVVQILRMHGVDKFTSFNILDD-EELRSRIKEF 99 Query: 325 TGFRTVPQVFINGNCVGGGSDVKALYESGKL 417 + + T+PQV+I G VGG + +++ G L Sbjct: 100 SEWPTIPQVYIGGEFVGGCDIMIKMHQEGDL 130 >SB_45745| Best HMM Match : Glutaredoxin (HMM E-Value=0.00065) Length = 152 Score = 42.3 bits (95), Expect = 3e-04 Identities = 28/91 (30%), Positives = 45/91 (49%), Gaps = 4/91 (4%) Frame = +1 Query: 157 IKEAISKDKVVVFSKSYC--PYCKLAKDVFEKVKQP--IKVIELNERDDGNTIQDNLAQL 324 I E + KDKVVVF K P C + V + ++ K N DD ++ + + Sbjct: 41 IGETVKKDKVVVFMKGVPSQPMCGFSNAVVQILRMHGVDKFTSFNILDD-EELRSRIKEF 99 Query: 325 TGFRTVPQVFINGNCVGGGSDVKALYESGKL 417 + + T+PQV+I G VGG + +++ G L Sbjct: 100 SEWPTIPQVYIGGEFVGGCDIMIKMHQEGDL 130 >SB_1233| Best HMM Match : DUF547 (HMM E-Value=0) Length = 382 Score = 42.3 bits (95), Expect = 3e-04 Identities = 26/85 (30%), Positives = 46/85 (54%) Frame = +1 Query: 175 KDKVVVFSKSYCPYCKLAKDVFEKVKQPIKVIELNERDDGNTIQDNLAQLTGFRTVPQVF 354 K +V +FS + CP+C AK + ++ +++N Q+ + + +G RTVPQ+F Sbjct: 2 KGRVTIFSITGCPFCVRAKTKLRD-ELNLEFVDINLDRHPERRQEAMER-SGKRTVPQIF 59 Query: 355 INGNCVGGGSDVKALYESGKLEPML 429 N VGG D+ L + K+E ++ Sbjct: 60 FNNIHVGGFDDLDKL-SADKMEELI 83 >SB_52133| Best HMM Match : Glutaredoxin (HMM E-Value=4.4e-17) Length = 374 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/73 (30%), Positives = 37/73 (50%) Frame = +1 Query: 217 CKLAKDVFEKVKQPIKVIELNERDDGNTIQDNLAQLTGFRTVPQVFINGNCVGGGSDVKA 396 C+ K +F+ + I ++ + D Q VPQVF+NG C+GG ++ Sbjct: 239 CRFVKKLFDNLNVEIDERDIFIHKEHQVELDRRLQEEK-APVPQVFVNGICLGGSKELLH 297 Query: 397 LYESGKLEPMLIG 435 L E+G+L+ +L G Sbjct: 298 LNETGELKELLSG 310 >SB_20536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 36 Score = 37.1 bits (82), Expect = 0.012 Identities = 17/30 (56%), Positives = 21/30 (70%) Frame = +1 Query: 340 VPQVFINGNCVGGGSDVKALYESGKLEPML 429 VPQV ING +GGG++ + L SGKL ML Sbjct: 1 VPQVHINGKFIGGGTETEDLERSGKLLEML 30 >SB_31341| Best HMM Match : UDP-g_GGTase (HMM E-Value=0) Length = 1031 Score = 31.5 bits (68), Expect = 0.62 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +1 Query: 277 NERDDGNTIQDNLAQLTGFRTVPQVFING 363 +E DDG TGF+T PQV +NG Sbjct: 490 SENDDGRKAWKRFHDRTGFQTTPQVVVNG 518 >SB_43439| Best HMM Match : AhpC-TSA (HMM E-Value=9.80909e-44) Length = 246 Score = 30.7 bits (66), Expect = 1.1 Identities = 20/72 (27%), Positives = 38/72 (52%) Frame = +1 Query: 181 KVVVFSKSYCPYCKLAKDVFEKVKQPIKVIELNERDDGNTIQDNLAQLTGFRTVPQVFIN 360 +V + +K C +C AK + + ++ E+ +G + +L ++G T PQVF++ Sbjct: 172 RVTLITKPGCSHCTRAKVALQN--KGLRYEEIVLGVNGVSFS-SLNAISGQGTTPQVFVD 228 Query: 361 GNCVGGGSDVKA 396 G VG D++A Sbjct: 229 GVHVGTADDLEA 240 >SB_38289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 560 Score = 30.3 bits (65), Expect = 1.4 Identities = 17/45 (37%), Positives = 27/45 (60%), Gaps = 3/45 (6%) Frame = +1 Query: 214 YCKLAKDVFEKVKQPIKVIELNERDDGNT---IQDNLAQLTGFRT 339 Y KLA D+ E ++ IK+I+L ER+ NT +Q + + +RT Sbjct: 236 YEKLASDLLEWIE--IKIIQLGEREFANTLLGVQQQMLEFNQYRT 278 >SB_17581| Best HMM Match : HHH (HMM E-Value=4.2) Length = 361 Score = 29.9 bits (64), Expect = 1.9 Identities = 16/55 (29%), Positives = 25/55 (45%) Frame = +1 Query: 178 DKVVVFSKSYCPYCKLAKDVFEKVKQPIKVIELNERDDGNTIQDNLAQLTGFRTV 342 DK + Y C+ + F K P+K+ LN+ +G I D + L G+ V Sbjct: 80 DKTKAVKEEYKRQCEANEQFFVKEAAPVKMAPLNDPSEGKIILD-IKGLKGYELV 133 >SB_30152| Best HMM Match : Ank (HMM E-Value=1.8e-23) Length = 393 Score = 28.3 bits (60), Expect = 5.8 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -3 Query: 378 TSHTVAIYKDLRYSSETSQLCEIILNGVS 292 T HT +IY L+Y + + CE IL+ ++ Sbjct: 326 TPHTKSIYMALKYKVHSFKACETILDAIT 354 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,751,214 Number of Sequences: 59808 Number of extensions: 362753 Number of successful extensions: 861 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 819 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 858 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1669334250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -