BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_I01 (653 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 24 1.1 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 24 1.5 DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 22 6.0 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 24.2 bits (50), Expect = 1.1 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = -1 Query: 437 YPINIGSNFPDSYNALTSEP 378 YPI G +FP Y T+ P Sbjct: 384 YPIGSGGSFPSLYPMATTSP 403 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -1 Query: 416 NFPDSYNALTSEPPPTQLPFIKT 348 N D+Y ++ S P T LPF+ T Sbjct: 917 NMLDTYESVHSFPTETGLPFVYT 939 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 21.8 bits (44), Expect = 6.0 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = -3 Query: 414 FSRFIQCFNIRATSHTVAIYKDLRYSSETSQL 319 F IQ +N+ SHTV + L+ E S L Sbjct: 64 FGLSIQHYNVDEYSHTVDFHVMLKLMWEQSHL 95 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 174,985 Number of Sequences: 438 Number of extensions: 3432 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19804986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -