BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_H24 (650 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory recept... 23 2.2 AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory recept... 22 3.8 AM292345-1|CAL23157.2| 384|Tribolium castaneum gustatory recept... 22 3.8 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 22 5.0 >AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory receptor candidate 15 protein. Length = 455 Score = 23.0 bits (47), Expect = 2.2 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = +1 Query: 145 RFKKWNIYFNGVEKEM 192 R + WN+ FNG K + Sbjct: 268 RMETWNVVFNGSRKNL 283 >AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory receptor candidate 53 protein. Length = 659 Score = 22.2 bits (45), Expect = 3.8 Identities = 12/43 (27%), Positives = 21/43 (48%) Frame = +3 Query: 513 VLAGALVSIANKYGDTPLDKXRGQLVQRLHELXXQQGQDLKKI 641 V+ G L IAN GDT + + ++ ++ Q +L K+ Sbjct: 421 VIIGTLAIIANLNGDTMIVEAMAYILLAMNSAVCHQTIELVKM 463 >AM292345-1|CAL23157.2| 384|Tribolium castaneum gustatory receptor candidate 24 protein. Length = 384 Score = 22.2 bits (45), Expect = 3.8 Identities = 12/43 (27%), Positives = 21/43 (48%) Frame = +3 Query: 513 VLAGALVSIANKYGDTPLDKXRGQLVQRLHELXXQQGQDLKKI 641 V+ G L IAN GDT + + ++ ++ Q +L K+ Sbjct: 146 VIIGTLAIIANLNGDTMIVEAMAYILLAMNSAVCHQTIELVKM 188 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 21.8 bits (44), Expect = 5.0 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 281 ASPMKWTKAMIIALIHIMFGI 219 AS + W K +II + + +GI Sbjct: 1350 ASQIHWQKIIIIVMSSVTYGI 1370 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 132,706 Number of Sequences: 336 Number of extensions: 2527 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16760905 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -