BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_H23 (654 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 pro... 25 2.8 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 24 3.7 AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR ... 24 4.8 >DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 protein. Length = 961 Score = 24.6 bits (51), Expect = 2.8 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -3 Query: 121 FCVHCFTILKFMLQKTDSILFFEK*KPADDGRTLMKYW 8 F + C L L+K +S LF + +PAD L K W Sbjct: 55 FLLQCLDDLDRNLRKLNSRLFVIRGQPADALPKLFKEW 92 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 24.2 bits (50), Expect = 3.7 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -3 Query: 343 KCRIFRSEMIFQLQTSCHPSHLTVTTLEKDIG 248 K R++ + + + LQ S + +TLE DIG Sbjct: 1071 KDRLYDAYITYSLQDEHFVSQILTSTLENDIG 1102 >AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR protein. Length = 640 Score = 23.8 bits (49), Expect = 4.8 Identities = 12/36 (33%), Positives = 15/36 (41%) Frame = -3 Query: 337 RIFRSEMIFQLQTSCHPSHLTVTTLEKDIGQHFDEC 230 R+ +S+ F Q C HL EK G EC Sbjct: 347 RMAKSKRKFSQQNCCEQQHLPHVHSEKCAGTQTGEC 382 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 637,060 Number of Sequences: 2352 Number of extensions: 12096 Number of successful extensions: 32 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64814025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -