BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_H22 (653 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 25 2.8 AF457565-1|AAL68795.1| 391|Anopheles gambiae TRIO protein protein. 24 3.7 AY583530-1|AAS93544.1| 260|Anopheles gambiae NOS protein protein. 23 6.4 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 24.6 bits (51), Expect = 2.8 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -1 Query: 482 AHIATISGELLITFCGIXFHKNF 414 A I +SG L ITFCGI KN+ Sbjct: 491 AEIFHMSGILAITFCGITM-KNY 512 >AF457565-1|AAL68795.1| 391|Anopheles gambiae TRIO protein protein. Length = 391 Score = 24.2 bits (50), Expect = 3.7 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = -2 Query: 478 ILQLFQGSYSLHFVVXXSIKILHYTDHFDT 389 ++QL Y F SI H+ DHFDT Sbjct: 245 VVQLRDNLYKNSFATLVSIA-RHFPDHFDT 273 >AY583530-1|AAS93544.1| 260|Anopheles gambiae NOS protein protein. Length = 260 Score = 23.4 bits (48), Expect = 6.4 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = +1 Query: 532 LAAYSWTEPVSNIIRALEENVRXRTLNLIGRSYSSIKI 645 LA Y W E ++ R +N LIG+S+ I + Sbjct: 22 LAPYGWDEQMNEAAREFLKNYSDFIPMLIGQSHYKIDL 59 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 594,763 Number of Sequences: 2352 Number of extensions: 10354 Number of successful extensions: 13 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64814025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -