BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_H22 (653 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT011518-1|AAS15654.1| 182|Drosophila melanogaster SD12355p pro... 55 7e-08 AE014134-1472|AAN10662.2| 182|Drosophila melanogaster CG13383-P... 55 7e-08 >BT011518-1|AAS15654.1| 182|Drosophila melanogaster SD12355p protein. Length = 182 Score = 55.2 bits (127), Expect = 7e-08 Identities = 30/92 (32%), Positives = 46/92 (50%) Frame = +1 Query: 364 YAQLLXIYLYQNDLCNAKFLWXXIPQNVMSSSPEIVAIWAIGQKLWKKDLPXTYEALAAY 543 Y QLL IYLYQN L +AK LW +P N + E++ + + L + ++ + Y Sbjct: 28 YQQLLAIYLYQNKLADAKLLWMRVPAN-LRDDKELIQLNLLNIALQNNNYADFFKHI-KY 85 Query: 544 SWTEPVSNIIRALEENVRXRTLNLIGRSYSSI 639 W+E V + + L R L+G +Y SI Sbjct: 86 EWSERVKSPVEDLLNKQREELFKLMGSAYMSI 117 >AE014134-1472|AAN10662.2| 182|Drosophila melanogaster CG13383-PB protein. Length = 182 Score = 55.2 bits (127), Expect = 7e-08 Identities = 30/92 (32%), Positives = 46/92 (50%) Frame = +1 Query: 364 YAQLLXIYLYQNDLCNAKFLWXXIPQNVMSSSPEIVAIWAIGQKLWKKDLPXTYEALAAY 543 Y QLL IYLYQN L +AK LW +P N + E++ + + L + ++ + Y Sbjct: 28 YQQLLAIYLYQNKLADAKLLWMRVPAN-LRDDKELIQLNLLNIALQNNNYADFFKHI-KY 85 Query: 544 SWTEPVSNIIRALEENVRXRTLNLIGRSYSSI 639 W+E V + + L R L+G +Y SI Sbjct: 86 EWSERVKSPVEDLLNKQREELFKLMGSAYMSI 117 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,532,022 Number of Sequences: 53049 Number of extensions: 414563 Number of successful extensions: 812 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 807 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 812 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2786177250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -