BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_H22 (653 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z83744-4|CAB06040.4| 735|Caenorhabditis elegans Hypothetical pr... 31 0.94 Z82069-1|CAB04902.1| 667|Caenorhabditis elegans Hypothetical pr... 30 1.6 AF016424-5|AAB65326.1| 282|Caenorhabditis elegans Hypothetical ... 29 3.8 >Z83744-4|CAB06040.4| 735|Caenorhabditis elegans Hypothetical protein C06A12.4 protein. Length = 735 Score = 30.7 bits (66), Expect = 0.94 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +3 Query: 141 FIMFYFXSGNKKFTIFNNFLLGLLNWC 221 FI+F F NK T+ +F + NWC Sbjct: 112 FILFIFYQMNKLITVIRDFSYSVYNWC 138 >Z82069-1|CAB04902.1| 667|Caenorhabditis elegans Hypothetical protein W04A8.1 protein. Length = 667 Score = 29.9 bits (64), Expect = 1.6 Identities = 16/32 (50%), Positives = 21/32 (65%) Frame = -3 Query: 129 EANNKIRDTIXFNNLTNSKKPRGTKKYKQKFV 34 EANN +R+T +N +KKPR T+K QK V Sbjct: 338 EANNDVRNT--WNPELGAKKPRKTRKAPQKTV 367 >AF016424-5|AAB65326.1| 282|Caenorhabditis elegans Hypothetical protein F39G3.4 protein. Length = 282 Score = 28.7 bits (61), Expect = 3.8 Identities = 18/65 (27%), Positives = 26/65 (40%), Gaps = 2/65 (3%) Frame = -1 Query: 614 RFRVLXRTFSSKALIMLETGSVQE*AANASYVXGKSF--FHSFCPIAHIATISGELLITF 441 R +L TF A I+L G++ Y F HS+ + + SG+L F Sbjct: 127 RVSILIHTFLHIASIVLAVGALFSIILTIKYTGASHFSNIHSYLGVCLLLVYSGQLSFGF 186 Query: 440 CGIXF 426 C F Sbjct: 187 CTYLF 191 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,161,299 Number of Sequences: 27780 Number of extensions: 233123 Number of successful extensions: 528 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 503 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 528 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1455289764 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -