BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_H19 (655 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF134820-1|AAD40235.1| 166|Apis mellifera putative Ets-family p... 27 0.12 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 24 1.5 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 23 3.4 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 22 6.0 D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. 21 7.9 AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 21 7.9 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 21 7.9 AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 21 7.9 >AF134820-1|AAD40235.1| 166|Apis mellifera putative Ets-family protein protein. Length = 166 Score = 27.5 bits (58), Expect = 0.12 Identities = 18/56 (32%), Positives = 25/56 (44%) Frame = +1 Query: 247 TKQYDKSENDLKALQSVGQIVGEVLKQLTEXKFIVKATNGPRYVVGCRRQLDKNKL 414 T + DKSE L Q+ G I + L+ I K GP + G R ++ N L Sbjct: 100 TSRLDKSEISLATKQACGFIDNIDKRNLSVTSMIQKRALGPSFSTGERCRISSNFL 155 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 23.8 bits (49), Expect = 1.5 Identities = 9/22 (40%), Positives = 16/22 (72%) Frame = +1 Query: 148 LREKAFQDYRKKLMEHKEVESR 213 +RE+ + YR+ L+EHK+ +R Sbjct: 139 IREQTEEMYREMLLEHKKRRAR 160 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 22.6 bits (46), Expect = 3.4 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = +1 Query: 271 NDLKALQSVGQIVGEVLKQLTEXKFIVKATNGPRYVV 381 N L S + +VLK+ K +VK GP+ V+ Sbjct: 55 NALDLFGSPDAMFSQVLKKAENFKDVVKIWVGPKLVI 91 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.8 bits (44), Expect = 6.0 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = +2 Query: 158 RPSRITERSSWSIRKSSHDSKKVVTN*KI*PNNMTRVK 271 +P + RS+ + + D+ VVT K +N+T K Sbjct: 983 KPPSVVSRSTQTSANNDKDTNAVVTQSKEARDNITATK 1020 >D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.4 bits (43), Expect = 7.9 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = -2 Query: 381 NNVARAISSFYNKF 340 NNV + ++ FYN F Sbjct: 521 NNVPKKLNMFYNNF 534 >AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.4 bits (43), Expect = 7.9 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = -2 Query: 381 NNVARAISSFYNKF 340 NNV + ++ FYN F Sbjct: 521 NNVPKKLNMFYNNF 534 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 21.4 bits (43), Expect = 7.9 Identities = 13/47 (27%), Positives = 22/47 (46%) Frame = +1 Query: 376 VVGCRRQLDKNKLKGGTRVALDMTTLTIMRHLPREVDPLVYNMSHED 516 +V C +DK +K +V T I R L +E ++ + H+D Sbjct: 431 IVKCTDFVDKAMVKQYVKVKHSATLGYISRVLEKEPYVIILDDEHDD 477 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 21.4 bits (43), Expect = 7.9 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = -1 Query: 538 RNRSRHQDPHDSCCK 494 RN R DPHD K Sbjct: 178 RNERRTPDPHDETAK 192 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,557 Number of Sequences: 438 Number of extensions: 3379 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19804986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -