BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_H19 (655 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g43010.1 68418.m05245 26S proteasome AAA-ATPase subunit (RPT4... 239 9e-64 At1g45000.1 68414.m05158 26S proteasome regulatory complex subun... 239 9e-64 At5g19990.1 68418.m02379 26S proteasome AAA-ATPase subunit (RPT6a) 106 1e-23 At5g20000.1 68418.m02380 26S proteasome AAA-ATPase subunit, puta... 105 3e-23 At4g29040.1 68417.m04153 26S proteasome AAA-ATPase subunit (RPT2... 92 3e-19 At2g20140.1 68415.m02353 26S protease regulatory complex subunit... 92 3e-19 At1g53780.1 68414.m06120 26S proteasome AAA-ATPase subunit, puta... 90 1e-18 At5g58290.1 68418.m07297 26S proteasome AAA-ATPase subunit (RPT3... 89 2e-18 At1g53750.1 68414.m06115 26S proteasome AAA-ATPase subunit (RPT1... 88 6e-18 At3g05530.1 68416.m00606 26S proteasome AAA-ATPase subunit (RPT5... 61 5e-10 At1g09100.1 68414.m01016 26S protease regulatory subunit 6A, put... 61 5e-10 At3g09840.1 68416.m01174 cell division cycle protein 48 (CDC48A)... 54 8e-08 At5g03340.1 68418.m00286 cell division cycle protein 48, putativ... 52 3e-07 At3g53230.1 68416.m05865 cell division cycle protein 48, putativ... 52 3e-07 At1g05910.1 68414.m00620 cell division cycle protein 48-related ... 46 2e-05 At3g47060.1 68416.m05110 FtsH protease, putative contains simila... 40 0.002 At5g58870.1 68418.m07376 FtsH protease, putative contains simila... 39 0.003 At4g24860.1 68417.m03559 AAA-type ATPase family protein contains... 39 0.003 At3g15120.1 68416.m01913 AAA-type ATPase family protein contains... 39 0.003 At4g23940.1 68417.m03443 FtsH protease, putative contains simila... 37 0.013 At2g03670.1 68415.m00326 AAA-type ATPase family protein contains... 36 0.018 At3g01610.1 68416.m00092 AAA-type ATPase family protein contains... 36 0.024 At1g02890.1 68414.m00256 AAA-type ATPase family protein contains... 36 0.024 At4g28000.1 68417.m04016 AAA-type ATPase family protein contains... 35 0.054 At1g64110.2 68414.m07264 AAA-type ATPase family protein contains... 35 0.054 At1g64110.1 68414.m07263 AAA-type ATPase family protein contains... 35 0.054 At4g27680.1 68417.m03980 MSP1 protein, putative / intramitochond... 34 0.072 At4g02480.1 68417.m00335 AAA-type ATPase family protein contains... 34 0.072 At3g56690.1 68416.m06306 calmodulin-binding protein identical to... 34 0.072 At1g50140.1 68414.m05623 AAA-type ATPase family protein contains... 34 0.095 At5g53540.1 68418.m06653 MSP1 protein, putative / intramitochond... 33 0.17 At3g19740.1 68416.m02499 AAA-type ATPase family protein contains... 33 0.17 At5g42270.1 68418.m05145 FtsH protease, putative similar to FtsH... 33 0.22 At1g62130.1 68414.m07010 AAA-type ATPase family protein contains... 31 0.51 At1g50250.1 68414.m05634 cell division protein ftsH homolog 1, c... 31 0.51 At2g34450.1 68415.m04227 high mobility group (HMG1/2) family pro... 31 0.88 At2g30950.1 68415.m03775 FtsH protease (VAR2) identical to zinc ... 31 0.88 At1g06430.1 68414.m00680 FtsH protease, putative similar to zinc... 31 0.88 At3g61130.1 68416.m06841 glycosyl transferase family 8 protein c... 30 1.5 At2g33793.1 68415.m04145 expressed protein 30 1.5 At1g51940.1 68414.m05855 protein kinase family protein / peptido... 30 1.5 At3g19670.1 68416.m02492 FF domain-containing protein / WW domai... 29 2.0 At3g49840.1 68416.m05449 proline-rich family protein contains pr... 29 2.7 At5g53170.1 68418.m06610 FtsH protease, putative similar to ATP-... 29 3.6 At1g03000.1 68414.m00271 AAA-type ATPase family protein contains... 28 4.7 At5g60070.1 68418.m07532 ankyrin repeat family protein contains ... 28 6.2 At5g48660.1 68418.m06022 expressed protein ; expression supporte... 28 6.2 At5g15250.1 68418.m01786 FtsH protease, putative similar to FtsH... 28 6.2 At5g11260.1 68418.m01315 bZIP protein HY5 (HY5) identical to HY5... 27 8.2 At3g54670.1 68416.m06049 structural maintenance of chromosomes (... 27 8.2 At2g47330.1 68415.m05908 DEAD/DEAH box helicase, putative simila... 27 8.2 >At5g43010.1 68418.m05245 26S proteasome AAA-ATPase subunit (RPT4a) gb|AAF22524.1 Length = 399 Score = 239 bits (586), Expect = 9e-64 Identities = 110/168 (65%), Positives = 139/168 (82%) Frame = +1 Query: 151 REKAFQDYRKKLMEHKEVESRLKEGRDQLKDLTKQYDKSENDLKALQSVGQIVGEVLKQL 330 R A +YRKKL++HKE+ESR++ R+ L+ K+++K+E+DLK+LQSVGQI+GEVL+ L Sbjct: 11 RTAAVSEYRKKLLQHKELESRVRTARENLRGAKKEFNKTEDDLKSLQSVGQIIGEVLRPL 70 Query: 331 TEXKFIVKATNGPRYVVGCRRQLDKNKLKGGTRVALDMTTLTIMRHLPREVDPLVYNMSH 510 + IVKA++GPRYVVGCR ++DK KL GTRV LDMTTLTIMR LPREVDP+VYNM H Sbjct: 71 DNERLIVKASSGPRYVVGCRSKVDKEKLTSGTRVVLDMTTLTIMRALPREVDPVVYNMLH 130 Query: 511 EDPGDVTYSAIGXLQEQITQLXEVIELPLMNPELFVRVGITPPKGCLL 654 EDPG+++YSA+G L +QI +L E IELPLMNPELF+RVGI PPKG LL Sbjct: 131 EDPGNISYSAVGGLGDQIRELRESIELPLMNPELFLRVGIKPPKGVLL 178 >At1g45000.1 68414.m05158 26S proteasome regulatory complex subunit p42D, putative similar to 26S proteasome regulatory complex subunit p42D [Drosophila melanogaster] gi|6434958|gb|AAF08391 Length = 399 Score = 239 bits (586), Expect = 9e-64 Identities = 111/168 (66%), Positives = 138/168 (82%) Frame = +1 Query: 151 REKAFQDYRKKLMEHKEVESRLKEGRDQLKDLTKQYDKSENDLKALQSVGQIVGEVLKQL 330 R A DYRKKL+ HKE+ESR++ R+ L+ K+++K+E+DLK+LQSVGQI+GEVL+ L Sbjct: 11 RTAAVTDYRKKLLHHKELESRVRTARENLRAAKKEFNKTEDDLKSLQSVGQIIGEVLRPL 70 Query: 331 TEXKFIVKATNGPRYVVGCRRQLDKNKLKGGTRVALDMTTLTIMRHLPREVDPLVYNMSH 510 + IVKA++GPRYVVGCR ++DK KL GTRV LDMTTLTIMR LPREVDP+VYNM H Sbjct: 71 DNERLIVKASSGPRYVVGCRSKVDKEKLTSGTRVVLDMTTLTIMRALPREVDPVVYNMLH 130 Query: 511 EDPGDVTYSAIGXLQEQITQLXEVIELPLMNPELFVRVGITPPKGCLL 654 EDPG+++YSA+G L +QI +L E IELPLMNPELF+RVGI PPKG LL Sbjct: 131 EDPGNISYSAVGGLGDQIRELRESIELPLMNPELFLRVGIKPPKGVLL 178 >At5g19990.1 68418.m02379 26S proteasome AAA-ATPase subunit (RPT6a) Length = 419 Score = 106 bits (254), Expect = 1e-23 Identities = 63/177 (35%), Positives = 92/177 (51%) Frame = +1 Query: 124 ASTSDMEPLREKAFQDYRKKLMEHKEVESRLKEGRDQLKDLTKQYDKSENDLKALQSVGQ 303 A+ E L++ Q + + ++ + L Q +L + +L+ LQ G Sbjct: 24 AAAKQGEGLKQYYLQHIHELQRQLRQKTNNLNRLEAQRNELNSRVRMLREELQLLQEPGS 83 Query: 304 IVGEVLKQLTEXKFIVKATNGPRYVVGCRRQLDKNKLKGGTRVALDMTTLTIMRHLPREV 483 VGEV+K + + K +VK +YVV + +D K+ TRVAL + + LP +V Sbjct: 84 YVGEVVKVMGKNKVLVKVHPEGKYVVDIDKSIDITKITPSTRVALRNDSYVLHLVLPSKV 143 Query: 484 DPLVYNMSHEDPGDVTYSAIGXLQEQITQLXEVIELPLMNPELFVRVGITPPKGCLL 654 DPLV M E D TY IG L +QI ++ EVIELP+ +PELF +GI PKG LL Sbjct: 144 DPLVNLMKVEKVPDSTYDMIGGLDQQIKEIKEVIELPIKHPELFESLGIAQPKGVLL 200 >At5g20000.1 68418.m02380 26S proteasome AAA-ATPase subunit, putative almost identical to 26S proteasome AAA-ATPase subunit RPT6a GI:6652888 from [Arabidopsis thaliana]; almost identical to a member of conserved Sug1 CAD family AtSUG1 GI:13537115 from [Arabidopsis thaliana] Length = 419 Score = 105 bits (251), Expect = 3e-23 Identities = 64/163 (39%), Positives = 89/163 (54%), Gaps = 1/163 (0%) Frame = +1 Query: 169 DYRKKLMEHKEVE-SRLKEGRDQLKDLTKQYDKSENDLKALQSVGQIVGEVLKQLTEXKF 345 D ++L K +RL+ R++L + +L+ LQ G VGEV+K + + K Sbjct: 41 DELQRLQREKSYNLNRLEAQRNELNSRVRML---REELQLLQEPGSYVGEVVKVMGKNKV 97 Query: 346 IVKATNGPRYVVGCRRQLDKNKLKGGTRVALDMTTLTIMRHLPREVDPLVYNMSHEDPGD 525 +VK +YVV + +D KL TRVAL + + LP +VDPLV M E D Sbjct: 98 LVKVHPEGKYVVDIDKSIDITKLTPSTRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPD 157 Query: 526 VTYSAIGXLQEQITQLXEVIELPLMNPELFVRVGITPPKGCLL 654 TY IG L +QI ++ EVIELP+ +PELF +GI PKG LL Sbjct: 158 STYDMIGGLDQQIKEIKEVIELPIKHPELFESLGIAQPKGVLL 200 >At4g29040.1 68417.m04153 26S proteasome AAA-ATPase subunit (RPT2a) almost identical to 26S proteasome AAA-ATPase subunit RPT2a (GI:6652880) {Arabidopsis thaliana}; Drosophila melanogaster 26S proteasome subunit 4 ATPase, PID:g1066065 Length = 443 Score = 91.9 bits (218), Expect = 3e-19 Identities = 48/159 (30%), Positives = 89/159 (55%) Frame = +1 Query: 178 KKLMEHKEVESRLKEGRDQLKDLTKQYDKSENDLKALQSVGQIVGEVLKQLTEXKFIVKA 357 +++ ++ +E +++LK ++ ++ + + L+ VG + + + E IV + Sbjct: 69 ERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSS 128 Query: 358 TNGPRYVVGCRRQLDKNKLKGGTRVALDMTTLTIMRHLPREVDPLVYNMSHEDPGDVTYS 537 + GP Y VG +DK++L+ G + + L+++ L EVDP+V M E +Y+ Sbjct: 129 SVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMVSVMKVEKAPLESYA 188 Query: 538 AIGXLQEQITQLXEVIELPLMNPELFVRVGITPPKGCLL 654 IG L+ QI ++ E +ELPL +PEL+ +GI PPKG +L Sbjct: 189 DIGGLEAQIQEIKEAVELPLTHPELYEDIGIKPPKGVIL 227 >At2g20140.1 68415.m02353 26S protease regulatory complex subunit 4, putative similar to Swiss-Prot:P48601 26S protease regulatory subunit 4 (P26S4) [Drosophila melanogaster] Length = 443 Score = 91.9 bits (218), Expect = 3e-19 Identities = 48/159 (30%), Positives = 89/159 (55%) Frame = +1 Query: 178 KKLMEHKEVESRLKEGRDQLKDLTKQYDKSENDLKALQSVGQIVGEVLKQLTEXKFIVKA 357 +++ ++ +E +++LK ++ ++ + + L+ VG + + + E IV + Sbjct: 69 ERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSS 128 Query: 358 TNGPRYVVGCRRQLDKNKLKGGTRVALDMTTLTIMRHLPREVDPLVYNMSHEDPGDVTYS 537 + GP Y VG +DK++L+ G + + L+++ L EVDP+V M E +Y+ Sbjct: 129 SVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMVSVMKVEKAPLESYA 188 Query: 538 AIGXLQEQITQLXEVIELPLMNPELFVRVGITPPKGCLL 654 IG L+ QI ++ E +ELPL +PEL+ +GI PPKG +L Sbjct: 189 DIGGLEAQIQEIKEAVELPLTHPELYEDIGIKPPKGVIL 227 >At1g53780.1 68414.m06120 26S proteasome AAA-ATPase subunit, putative similar to 26S proteasome AAA-ATPase subunit RPT1 SP:Q41365 from [Spinacia oleracea] Length = 464 Score = 89.8 bits (213), Expect = 1e-18 Identities = 44/106 (41%), Positives = 64/106 (60%) Frame = +1 Query: 334 EXKFIVKATNGPRYVVGCRRQLDKNKLKGGTRVALDMTTLTIMRHLPREVDPLVYNMSHE 513 + K++V +YVVG + ++ G RV +D I LP ++DP V M+ E Sbjct: 138 DAKYVVDIKKIGKYVVGLGDKASPTDIEAGMRVGVDQKKYQIQIPLPPKIDPSVTMMTVE 197 Query: 514 DPGDVTYSAIGXLQEQITQLXEVIELPLMNPELFVRVGITPPKGCL 651 + D TYS IG +EQI ++ EV+ELP+++PE FVR+GI PPKG L Sbjct: 198 EKPDATYSDIGGCKEQIEKIREVVELPMLHPEKFVRLGIDPPKGVL 243 >At5g58290.1 68418.m07297 26S proteasome AAA-ATPase subunit (RPT3) identical to 26S proteasome AAA-ATPase subunit RPT3 GI:6652882 from [Arabidopsis thaliana] Length = 408 Score = 89.4 bits (212), Expect = 2e-18 Identities = 52/179 (29%), Positives = 97/179 (54%) Frame = +1 Query: 118 MPASTSDMEPLREKAFQDYRKKLMEHKEVESRLKEGRDQLKDLTKQYDKSENDLKALQSV 297 M ST+D E L + R+ +E +++ +D+ K+L ++ +++ ++K +QSV Sbjct: 20 MDLSTADEEDLYGRLKSLERQ--LEFTDIQEEYV--KDEQKNLKRELLRAQEEVKRIQSV 75 Query: 298 GQIVGEVLKQLTEXKFIVKATNGPRYVVGCRRQLDKNKLKGGTRVALDMTTLTIMRHLPR 477 ++G+ ++ + + IV +T G Y V +++ LK VAL + ++ LP Sbjct: 76 PLVIGQFMEMVDQNNGIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPP 135 Query: 478 EVDPLVYNMSHEDPGDVTYSAIGXLQEQITQLXEVIELPLMNPELFVRVGITPPKGCLL 654 E D + +S + DV+Y+ IG Q ++ E +ELPL + EL+ ++GI PP+G LL Sbjct: 136 EADSSISLLSQSEKPDVSYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLL 194 >At1g53750.1 68414.m06115 26S proteasome AAA-ATPase subunit (RPT1a) similar to 26S proteasome ATPase subunit GI:1395190 from [Spinacia oleracea] Length = 426 Score = 87.8 bits (208), Expect = 6e-18 Identities = 40/106 (37%), Positives = 66/106 (62%) Frame = +1 Query: 334 EXKFIVKATNGPRYVVGCRRQLDKNKLKGGTRVALDMTTLTIMRHLPREVDPLVYNMSHE 513 + K+++ ++VVG ++ ++ G RV +D I LP ++DP V M+ E Sbjct: 101 DAKYVINVKQIAKFVVGLGDKVSPTDIEEGMRVGVDRNKYQIQIPLPPKIDPSVTMMTVE 160 Query: 514 DPGDVTYSAIGXLQEQITQLXEVIELPLMNPELFVRVGITPPKGCL 651 + DVTY+ +G +EQI ++ EV+ELP+++PE FV++GI PPKG L Sbjct: 161 EKPDVTYNDVGGCKEQIEKMREVVELPMLHPEKFVKLGIDPPKGVL 206 >At3g05530.1 68416.m00606 26S proteasome AAA-ATPase subunit (RPT5a) identical to GB:AAF22525 GI:6652886 from [Arabidopsis thaliana] Length = 424 Score = 61.3 bits (142), Expect = 5e-10 Identities = 32/86 (37%), Positives = 49/86 (56%) Frame = +1 Query: 397 LDKNKLKGGTRVALDMTTLTIMRHLPREVDPLVYNMSHEDPGDVTYSAIGXLQEQITQLX 576 +D + LK G V ++ + I+ LP E D V M ++ Y+ IG L++QI +L Sbjct: 125 VDPDSLKPGDLVGVNKDSYLILDTLPSEYDSRVKAMEVDEKPTEDYNDIGGLEKQIQELV 184 Query: 577 EVIELPLMNPELFVRVGITPPKGCLL 654 E I LP+ + E F ++G+ PPKG LL Sbjct: 185 EAIVLPMTHKERFEKLGVRPPKGVLL 210 >At1g09100.1 68414.m01016 26S protease regulatory subunit 6A, putative identical to SP:O04019 from [Arabidopsis thaliana] Length = 423 Score = 61.3 bits (142), Expect = 5e-10 Identities = 33/86 (38%), Positives = 49/86 (56%) Frame = +1 Query: 397 LDKNKLKGGTRVALDMTTLTIMRHLPREVDPLVYNMSHEDPGDVTYSAIGXLQEQITQLX 576 +D + LK G V ++ + I+ LP E D V M ++ Y+ IG L++QI +L Sbjct: 124 VDPDTLKPGDLVGVNKDSYLILDTLPSEYDSRVKAMEVDEKPTEDYNDIGGLEKQIQELV 183 Query: 577 EVIELPLMNPELFVRVGITPPKGCLL 654 E I LP+ + E F ++GI PPKG LL Sbjct: 184 EAIVLPMTHKEQFEKLGIRPPKGVLL 209 >At3g09840.1 68416.m01174 cell division cycle protein 48 (CDC48A) (CDC48) identical to SP|P54609 Cell division cycle protein 48 homolog {Arabidopsis thaliana} Length = 809 Score = 54.0 bits (124), Expect = 8e-08 Identities = 21/44 (47%), Positives = 33/44 (75%) Frame = +1 Query: 523 DVTYSAIGXLQEQITQLXEVIELPLMNPELFVRVGITPPKGCLL 654 DV Y +G +++Q+ Q+ E++ELPL +P+LF +G+ PPKG LL Sbjct: 203 DVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILL 246 >At5g03340.1 68418.m00286 cell division cycle protein 48, putative / CDC48, putative very strong similarity to SP|P54609 Cell division cycle protein 48 homolog {Arabidopsis thaliana}; contains Pfam profiles PF00004: ATPase AAA family, PF02359: Cell division protein 48 (CDC48) N-terminal domain; supporting cDNA gi|26449351|dbj|AK117125.1| Length = 810 Score = 52.4 bits (120), Expect = 3e-07 Identities = 20/44 (45%), Positives = 33/44 (75%) Frame = +1 Query: 523 DVTYSAIGXLQEQITQLXEVIELPLMNPELFVRVGITPPKGCLL 654 +V Y +G +++Q+ Q+ E++ELPL +P+LF +G+ PPKG LL Sbjct: 203 EVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILL 246 >At3g53230.1 68416.m05865 cell division cycle protein 48, putative / CDC48, putative very strong similarity to SP|P54609 Cell division cycle protein 48 homolog {Arabidopsis thaliana}; contains Pfam profiles PF00004: ATPase AAA family, PF02359: Cell division protein 48 (CDC48) N-terminal domain Length = 815 Score = 52.4 bits (120), Expect = 3e-07 Identities = 20/44 (45%), Positives = 33/44 (75%) Frame = +1 Query: 523 DVTYSAIGXLQEQITQLXEVIELPLMNPELFVRVGITPPKGCLL 654 +V Y +G +++Q+ Q+ E++ELPL +P+LF +G+ PPKG LL Sbjct: 204 EVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILL 247 >At1g05910.1 68414.m00620 cell division cycle protein 48-related / CDC48-related similar to SP|P54609 Cell division cycle protein 48 homolog {Arabidopsis thaliana}; contains Pfam profiles PF00004: ATPase AAA family, PF00439: Bromodomain Length = 1210 Score = 46.4 bits (105), Expect = 2e-05 Identities = 20/44 (45%), Positives = 26/44 (59%) Frame = +1 Query: 523 DVTYSAIGXLQEQITQLXEVIELPLMNPELFVRVGITPPKGCLL 654 D+ + IG L E I L E++ PL+ PE F ITPP+G LL Sbjct: 377 DINFDDIGGLSEYINDLKEMVFFPLLYPEFFASYSITPPRGVLL 420 >At3g47060.1 68416.m05110 FtsH protease, putative contains similarity to FtsH protease GI:13183728 from [Medicago sativa] Length = 802 Score = 39.5 bits (88), Expect = 0.002 Identities = 17/43 (39%), Positives = 28/43 (65%) Frame = +1 Query: 526 VTYSAIGXLQEQITQLXEVIELPLMNPELFVRVGITPPKGCLL 654 +T++ + + E +L E++E L NPE +VR+G PP+G LL Sbjct: 322 ITFADVAGVDEAKEELEEIVEF-LRNPEKYVRLGARPPRGVLL 363 >At5g58870.1 68418.m07376 FtsH protease, putative contains similarity to cell division protein FtsH homolog 3 SP:P73437 (EC 3.4.24.-) [strain PCC6803] {Synechocystis sp.} Length = 806 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/47 (36%), Positives = 29/47 (61%) Frame = +1 Query: 514 DPGDVTYSAIGXLQEQITQLXEVIELPLMNPELFVRVGITPPKGCLL 654 D +T++ + + E +L E++E L NP+ +VR+G PP+G LL Sbjct: 322 DGETITFADVAGVDEAKEELEEIVEF-LKNPDRYVRLGARPPRGVLL 367 >At4g24860.1 68417.m03559 AAA-type ATPase family protein contains Pfam profile PF00004: ATPase, AAA family Length = 1122 Score = 38.7 bits (86), Expect = 0.003 Identities = 21/45 (46%), Positives = 28/45 (62%), Gaps = 1/45 (2%) Frame = +1 Query: 523 DVTYSAIGXLQEQITQLXEVIELPLMNPELFVRVGITPP-KGCLL 654 DVT+ IG L++ L E++ LPL PELF + +T P KG LL Sbjct: 816 DVTFDDIGALEKVKDILKELVMLPLQRPELFCKGELTKPCKGILL 860 >At3g15120.1 68416.m01913 AAA-type ATPase family protein contains PROSITE domains, PS00674: AAA-protein family signature and PS00017: ATP/GTP-binding site motif A (P-loop) Length = 1954 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/34 (50%), Positives = 25/34 (73%), Gaps = 1/34 (2%) Frame = +1 Query: 556 EQITQ-LXEVIELPLMNPELFVRVGITPPKGCLL 654 E +TQ + EV+ +PL+ PE F +G+TPP+G LL Sbjct: 725 EGVTQCMKEVVLIPLLYPEFFDNLGLTPPRGILL 758 >At4g23940.1 68417.m03443 FtsH protease, putative contains similarity to zinc dependent protease GI:7650138 from [Arabidopsis thaliana] Length = 946 Score = 36.7 bits (81), Expect = 0.013 Identities = 16/43 (37%), Positives = 28/43 (65%) Frame = +1 Query: 526 VTYSAIGXLQEQITQLXEVIELPLMNPELFVRVGITPPKGCLL 654 V ++ + + E + +L E+++ L NP+LF ++GI PP G LL Sbjct: 427 VKFADVAGIDEAVDELQELVKY-LKNPDLFDKMGIKPPHGVLL 468 >At2g03670.1 68415.m00326 AAA-type ATPase family protein contains Pfam domain, PF00004: ATPase, AAA family ('A'TPases 'A'ssociated with diverse cellular 'A'ctivities) Length = 603 Score = 36.3 bits (80), Expect = 0.018 Identities = 15/43 (34%), Positives = 28/43 (65%) Frame = +1 Query: 526 VTYSAIGXLQEQITQLXEVIELPLMNPELFVRVGITPPKGCLL 654 VT+ +G L++ +L + +E P+ + FV++GI+P +G LL Sbjct: 283 VTWDDVGGLKDLKKKLQQAVEWPIKHSAAFVKMGISPMRGILL 325 >At3g01610.1 68416.m00092 AAA-type ATPase family protein contains Pfam domain, PF00004: ATPase, AAA family ('A'TPases 'A'ssociated with diverse cellular 'A'ctivities) Length = 820 Score = 35.9 bits (79), Expect = 0.024 Identities = 13/41 (31%), Positives = 25/41 (60%) Frame = +1 Query: 529 TYSAIGXLQEQITQLXEVIELPLMNPELFVRVGITPPKGCL 651 T+ G +++ + +L + P++NPE F ++G+ PP G L Sbjct: 231 TFKDFGGIKKILDELEMNVLFPILNPEPFKKIGVKPPSGIL 271 >At1g02890.1 68414.m00256 AAA-type ATPase family protein contains Pfam domain, PF00004: ATPase, AAA family; similar to mitochondrial sorting protein 1 (MSP1) (TAT-binding homolog 4) (Swiss-Prot:P28737) [Saccharomyces cerevisiae] Length = 1252 Score = 35.9 bits (79), Expect = 0.024 Identities = 20/44 (45%), Positives = 27/44 (61%), Gaps = 1/44 (2%) Frame = +1 Query: 526 VTYSAIGXLQEQITQLXEVIELPLMNPELFVRVGIT-PPKGCLL 654 V++S IG L+ L E++ LPL PELF + +T P KG LL Sbjct: 947 VSFSDIGALENVKDTLKELVMLPLQRPELFGKGQLTKPTKGILL 990 >At4g28000.1 68417.m04016 AAA-type ATPase family protein contains Pfam domain, PF00004: ATPase, AAA family Length = 726 Score = 34.7 bits (76), Expect = 0.054 Identities = 18/43 (41%), Positives = 25/43 (58%) Frame = +1 Query: 526 VTYSAIGXLQEQITQLXEVIELPLMNPELFVRVGITPPKGCLL 654 VT++ IG L E L E++ LPL P+LF + P +G LL Sbjct: 411 VTFADIGSLDETKESLQELVMLPLRRPDLFKGGLLKPCRGILL 453 >At1g64110.2 68414.m07264 AAA-type ATPase family protein contains Pfam domain, PF00004: ATPase, AAA family Length = 829 Score = 34.7 bits (76), Expect = 0.054 Identities = 18/44 (40%), Positives = 25/44 (56%) Frame = +1 Query: 523 DVTYSAIGXLQEQITQLXEVIELPLMNPELFVRVGITPPKGCLL 654 +VT+ IG L E L E++ LPL P+LF + P +G LL Sbjct: 517 NVTFKDIGALDEIKESLQELVMLPLRRPDLFTGGLLKPCRGILL 560 >At1g64110.1 68414.m07263 AAA-type ATPase family protein contains Pfam domain, PF00004: ATPase, AAA family Length = 824 Score = 34.7 bits (76), Expect = 0.054 Identities = 18/44 (40%), Positives = 25/44 (56%) Frame = +1 Query: 523 DVTYSAIGXLQEQITQLXEVIELPLMNPELFVRVGITPPKGCLL 654 +VT+ IG L E L E++ LPL P+LF + P +G LL Sbjct: 512 NVTFKDIGALDEIKESLQELVMLPLRRPDLFTGGLLKPCRGILL 555 >At4g27680.1 68417.m03980 MSP1 protein, putative / intramitochondrial sorting protein, putative similar to Swiss-Prot:P28737 MSP1 protein (TAT-binding homolog 4) [Saccharomyces cerevisiae]; contains Pfam domain, PF00004: ATPase, AAA family Length = 398 Score = 34.3 bits (75), Expect = 0.072 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Frame = +1 Query: 484 DPLVYNMSHEDPGDVTYSAIGXLQEQITQLXEVIELPLMNPELFVRVGIT-PPKGCLL 654 D + ++ + D DV + +IG L+ L E++ LPL PELF + P KG LL Sbjct: 67 DVIACDVINPDHIDVEFGSIGGLETIKQALYELVILPLKRPELFAYGKLLGPQKGVLL 124 >At4g02480.1 68417.m00335 AAA-type ATPase family protein contains Pfam domain, PF00004: ATPase, AAA family; similar to Spastin (Swiss-Prot:Q9UBP0) [Homo sapiens] and Spastin (Fragment) (Swiss-Prot:Q9QYY8) [Mus musculus]; similar to mitochondrial sorting protein 1 (MSP1) protein (TAT-binding homolog 4) (Swiss-Prot:P28737) [Saccharomyces cerevisiae] Length = 1265 Score = 34.3 bits (75), Expect = 0.072 Identities = 19/44 (43%), Positives = 26/44 (59%), Gaps = 1/44 (2%) Frame = +1 Query: 526 VTYSAIGXLQEQITQLXEVIELPLMNPELFVRVGIT-PPKGCLL 654 V++ IG L+ L E++ LPL PELF + +T P KG LL Sbjct: 960 VSFDDIGALENVKETLKELVMLPLQRPELFDKGQLTKPTKGILL 1003 >At3g56690.1 68416.m06306 calmodulin-binding protein identical to calmodulin-binding protein GI:6760428 from [Arabidopsis thaliana] Length = 1022 Score = 34.3 bits (75), Expect = 0.072 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = +1 Query: 526 VTYSAIGXLQEQITQLXEVIELPLMNPELFVRVGITPPKGCLL 654 V + +G E QL E +E P + + F R+G PP G L+ Sbjct: 721 VNWEDVGGQNEVKNQLMEAVEWPQKHQDAFKRIGTRPPSGILM 763 >At1g50140.1 68414.m05623 AAA-type ATPase family protein contains Pfam domain, PF00004: ATPase, AAA family Length = 640 Score = 33.9 bits (74), Expect = 0.095 Identities = 20/49 (40%), Positives = 28/49 (57%), Gaps = 3/49 (6%) Frame = +1 Query: 517 PGD--VTYSAIGXLQEQITQLXEVIELPLMNPELFVRVGITPP-KGCLL 654 PG+ V + IG L++ L E++ LP+ PELF R + P KG LL Sbjct: 343 PGEIGVKFEDIGALEDVKKALNELVILPMRRPELFARGNLLRPCKGILL 391 >At5g53540.1 68418.m06653 MSP1 protein, putative / intramitochondrial sorting protein, putative similar to Swiss-Prot:P28737 MSP1 protein (TAT-binding homolog 4) [Saccharomyces cerevisiae]; contains Pfam domain, PF00004: ATPase, AAA family Length = 403 Score = 33.1 bits (72), Expect = 0.17 Identities = 19/45 (42%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +1 Query: 523 DVTYSAIGXLQEQITQLXEVIELPLMNPELFVRVGIT-PPKGCLL 654 DV + +IG L+ L E++ LPL PELF + P KG LL Sbjct: 83 DVEFGSIGGLESIKQALYELVILPLKRPELFAYGKLLGPQKGVLL 127 >At3g19740.1 68416.m02499 AAA-type ATPase family protein contains Pfam domain, PF00004: ATPase, AAA family Length = 439 Score = 33.1 bits (72), Expect = 0.17 Identities = 20/49 (40%), Positives = 27/49 (55%), Gaps = 3/49 (6%) Frame = +1 Query: 517 PGD--VTYSAIGXLQEQITQLXEVIELPLMNPELFVRVGITPP-KGCLL 654 PG+ V + IG L+ L E++ LP+ PELF R + P KG LL Sbjct: 142 PGEIGVKFDDIGALEHVKKTLNELVILPMRRPELFTRGNLLRPCKGILL 190 >At5g42270.1 68418.m05145 FtsH protease, putative similar to FtsH protease GI:13183728 from [Medicago sativa] Length = 704 Score = 32.7 bits (71), Expect = 0.22 Identities = 15/43 (34%), Positives = 24/43 (55%) Frame = +1 Query: 526 VTYSAIGXLQEQITQLXEVIELPLMNPELFVRVGITPPKGCLL 654 VT+ + + +L EV++ L NP+ + +G PKGCLL Sbjct: 247 VTFGDVAGADQAKLELQEVVDF-LKNPDKYTALGAKIPKGCLL 288 >At1g62130.1 68414.m07010 AAA-type ATPase family protein contains Pfam domain, PF00004: ATPase, AAA family Length = 1025 Score = 31.5 bits (68), Expect = 0.51 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +1 Query: 526 VTYSAIGXLQEQITQLXEVIELPLMNPELFVRVGITPP-KGCLL 654 VT+ IG L+ L E++ LP PELF + +T P G LL Sbjct: 732 VTFDDIGALENVKDTLKELVMLPFQWPELFCKGQLTKPCNGILL 775 >At1g50250.1 68414.m05634 cell division protein ftsH homolog 1, chloroplast (FTSH1) (FTSH) identical to SP:Q39102 Cell division protein ftsH homolog 1, chloroplast precursor (EC 3.4.24.-) [Arabidopsis thaliana] Length = 716 Score = 31.5 bits (68), Expect = 0.51 Identities = 14/43 (32%), Positives = 25/43 (58%) Frame = +1 Query: 526 VTYSAIGXLQEQITQLXEVIELPLMNPELFVRVGITPPKGCLL 654 V+++ + + +L EV++ L NP+ + +G PKGCLL Sbjct: 259 VSFADVAGADQAKLELQEVVDF-LKNPDKYTALGAKIPKGCLL 300 >At2g34450.1 68415.m04227 high mobility group (HMG1/2) family protein similar to HMG protein [Arabidopsis thaliana] GI:2832361; contains Pfam profile PF00505: HMG (high mobility group) box Length = 151 Score = 30.7 bits (66), Expect = 0.88 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +1 Query: 235 LKDLTKQYDKSENDLKALQSVGQIVGEVLKQLT 333 L D KQY + D+K+++ +G+ GE K +T Sbjct: 74 LDDFRKQYQEENPDVKSMREIGKTCGEKWKTMT 106 >At2g30950.1 68415.m03775 FtsH protease (VAR2) identical to zinc dependent protease VAR2 GI:7650138 from [Arabidopsis thaliana] Length = 695 Score = 30.7 bits (66), Expect = 0.88 Identities = 17/43 (39%), Positives = 21/43 (48%) Frame = +1 Query: 526 VTYSAIGXLQEQITQLXEVIELPLMNPELFVRVGITPPKGCLL 654 VT+ + + E EV+E L PE F VG PKG LL Sbjct: 224 VTFDDVAGVDEAKQDFMEVVEF-LKKPERFTAVGAKIPKGVLL 265 >At1g06430.1 68414.m00680 FtsH protease, putative similar to zinc dependent protease GI:7650138 from [Arabidopsis thaliana] Length = 685 Score = 30.7 bits (66), Expect = 0.88 Identities = 17/43 (39%), Positives = 21/43 (48%) Frame = +1 Query: 526 VTYSAIGXLQEQITQLXEVIELPLMNPELFVRVGITPPKGCLL 654 VT+ + + E EV+E L PE F VG PKG LL Sbjct: 217 VTFDDVAGVDEAKQDFMEVVEF-LKKPERFTAVGARIPKGVLL 258 >At3g61130.1 68416.m06841 glycosyl transferase family 8 protein contains Pfam profile: PF01501 glycosyl transferase family 8 Length = 673 Score = 29.9 bits (64), Expect = 1.5 Identities = 13/51 (25%), Positives = 30/51 (58%) Frame = +1 Query: 196 KEVESRLKEGRDQLKDLTKQYDKSENDLKALQSVGQIVGEVLKQLTEXKFI 348 +E+++RLK+ + L + T D + + L+++GQ++ + QL + K + Sbjct: 245 QELQARLKDSQRVLGEATSDADLPRSAHEKLRAMGQVLAKAKMQLYDCKLV 295 >At2g33793.1 68415.m04145 expressed protein Length = 212 Score = 29.9 bits (64), Expect = 1.5 Identities = 22/65 (33%), Positives = 33/65 (50%), Gaps = 1/65 (1%) Frame = +1 Query: 133 SDMEPLREKAFQDYRKKLMEH-KEVESRLKEGRDQLKDLTKQYDKSENDLKALQSVGQIV 309 S ++ REKA +D RKK E V + +K D+LK +K + +N KAL + Sbjct: 45 SALQQFREKAHEDGRKKKEESISSVSTEVKSKIDELK--SKLEKERQNFSKALSKSSKEC 102 Query: 310 GEVLK 324 +LK Sbjct: 103 ENILK 107 >At1g51940.1 68414.m05855 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein contains protein kinases ATP-binding region signature, PROSITE:PS00107 Length = 651 Score = 29.9 bits (64), Expect = 1.5 Identities = 20/52 (38%), Positives = 30/52 (57%), Gaps = 2/52 (3%) Frame = -3 Query: 275 SFSLLSYCLVKSFSWSRPSLSRDSTSLCS--MSFFL*SWKAFSLNGSMSDVL 126 +F + L+ SFS S+P D+T LCS ++F ++FS+ SM DVL Sbjct: 4 TFYIFFLSLLPSFSSSKPMNCSDTTRLCSSFLAFKPNQNQSFSVIQSMFDVL 55 >At3g19670.1 68416.m02492 FF domain-containing protein / WW domain-containing protein weak similarity to huntingtin-interacting protein HYPA/FBP11 [Homo sapiens] GI:3341980; contains Pfam profiles PF01846: FF domain, PF00397: WW domain Length = 960 Score = 29.5 bits (63), Expect = 2.0 Identities = 15/49 (30%), Positives = 28/49 (57%) Frame = +1 Query: 127 STSDMEPLREKAFQDYRKKLMEHKEVESRLKEGRDQLKDLTKQYDKSEN 273 ST E R++ F+DY L KE +R+K+ + +D+ +++DK + Sbjct: 797 STIGDESFRKRCFEDYVSLL---KEQSNRIKQNKKVPEDVREEHDKGRD 842 >At3g49840.1 68416.m05449 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 606 Score = 29.1 bits (62), Expect = 2.7 Identities = 23/77 (29%), Positives = 41/77 (53%), Gaps = 3/77 (3%) Frame = +1 Query: 106 KLFTMPASTSDMEPLREKAFQDYRKKLMEHKEVESRLKEGRDQ-LKDLTKQYDK--SEND 276 KL T+P S SD+ P + R+KL + +E++ KE + LK+L ++ S ++ Sbjct: 383 KLRTVPLSESDIFPSSFHKTPEGRRKLTK-EELQKFTKESTENALKELVSSPEEGSSGSE 441 Query: 277 LKALQSVGQIVGEVLKQ 327 +A + + VGE K+ Sbjct: 442 KQAARGTSEPVGECTKK 458 >At5g53170.1 68418.m06610 FtsH protease, putative similar to ATP-dependent metalloprotease FtsH1 GI:3600100 from [Mus musculus] Length = 806 Score = 28.7 bits (61), Expect = 3.6 Identities = 16/42 (38%), Positives = 22/42 (52%) Frame = +1 Query: 529 TYSAIGXLQEQITQLXEVIELPLMNPELFVRVGITPPKGCLL 654 T+ + + +L EV+E L NP F R+G PKG LL Sbjct: 360 TFKDVKGCDDAKQELEEVVEY-LKNPSKFTRLGGKLPKGILL 400 >At1g03000.1 68414.m00271 AAA-type ATPase family protein contains Pfam domain, PF00004: ATPase, AAA family ('A'TPases 'A'ssociated with diverse cellular 'A'ctivities) Length = 941 Score = 28.3 bits (60), Expect = 4.7 Identities = 13/44 (29%), Positives = 26/44 (59%) Frame = +1 Query: 523 DVTYSAIGXLQEQITQLXEVIELPLMNPELFVRVGITPPKGCLL 654 +V + +G L++ T + + ++LPL++ +LF G+ G LL Sbjct: 654 NVKWDDVGGLEDVKTSILDTVQLPLLHKDLF-SSGLRKRSGVLL 696 >At5g60070.1 68418.m07532 ankyrin repeat family protein contains ankyrin repeat domains, Pfam:PF00023 Length = 548 Score = 27.9 bits (59), Expect = 6.2 Identities = 26/89 (29%), Positives = 38/89 (42%), Gaps = 5/89 (5%) Frame = +1 Query: 196 KEVESRLKEGRDQLKD-LTKQYDKSENDLKALQSVG--QIVGEVLKQLTEXKFIVKATNG 366 KE+ S E D+L+D L KQ E L G +V E++K KA NG Sbjct: 49 KEILSNHMESEDELRDLLRKQNQCGETALYVAAEYGDADVVAELIKYYDLEDAETKARNG 108 Query: 367 --PRYVVGCRRQLDKNKLKGGTRVALDMT 447 P ++ + +LD ++ L MT Sbjct: 109 FDPFHIAAKQGELDVLRVLMEEHPELSMT 137 >At5g48660.1 68418.m06022 expressed protein ; expression supported by MPSS Length = 219 Score = 27.9 bits (59), Expect = 6.2 Identities = 12/53 (22%), Positives = 30/53 (56%) Frame = +1 Query: 133 SDMEPLREKAFQDYRKKLMEHKEVESRLKEGRDQLKDLTKQYDKSENDLKALQ 291 ++++ EKA ++ ++ ++ + RLK+ + K+ K+ + +E + ALQ Sbjct: 137 TELKEKEEKASKEIKQLQVKLSSITERLKKAETESKEKEKKLETAETHVTALQ 189 >At5g15250.1 68418.m01786 FtsH protease, putative similar to FtsH-like protein Pftf precursor GI:4325041 from [Nicotiana tabacum] Length = 687 Score = 27.9 bits (59), Expect = 6.2 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = +1 Query: 526 VTYSAIGXLQEQITQLXEVIELPLMNPELFVRVGITPPKGCLL 654 +T+ + + E E++E L PE F +G PKG LL Sbjct: 220 ITFEDVAGVDEAKQDFEEIVEF-LKTPEKFSALGAKIPKGVLL 261 >At5g11260.1 68418.m01315 bZIP protein HY5 (HY5) identical to HY5 protein GI:2251085 from [Arabidopsis thaliana] Length = 168 Score = 27.5 bits (58), Expect = 8.2 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = +1 Query: 214 LKEGRDQLKDLTKQYDKSENDLKALQSVGQIVGEVLKQLTEXK 342 L E +++KDL + + E L LQ+ Q++ +LK T K Sbjct: 113 LSELENRVKDLENKNSELEERLSTLQNENQMLRHILKNTTGNK 155 >At3g54670.1 68416.m06049 structural maintenance of chromosomes (SMC) family protein similar to SMC1 protein [Bos taurus] GI:4235253, 14S cohesin SMC1 subunit (SMC protein) [Xenopus laevis] GI:3328231; contains Pfam profiles PF02483: SMC family C-terminal domain, PF02463: RecF/RecN/SMC N terminal domain Length = 1257 Score = 27.5 bits (58), Expect = 8.2 Identities = 12/33 (36%), Positives = 22/33 (66%) Frame = +1 Query: 199 EVESRLKEGRDQLKDLTKQYDKSENDLKALQSV 297 ++++R+ E DQL DLT + ++E D + Q+V Sbjct: 478 KLKTRIAELEDQLSDLTAERYENERDSRLTQAV 510 >At2g47330.1 68415.m05908 DEAD/DEAH box helicase, putative similar to RNA helicase [Rattus norvegicus] GI:897915; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 760 Score = 27.5 bits (58), Expect = 8.2 Identities = 17/49 (34%), Positives = 23/49 (46%) Frame = +1 Query: 439 DMTTLTIMRHLPREVDPLVYNMSHEDPGDVTYSAIGXLQEQITQLXEVI 585 D TL +P +V+ L + DP VT +G E ITQ+ VI Sbjct: 406 DRQTLLFSATMPWKVEKLAREIL-SDPIRVTVGEVGMANEDITQVVNVI 453 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,929,727 Number of Sequences: 28952 Number of extensions: 238293 Number of successful extensions: 723 Number of sequences better than 10.0: 51 Number of HSP's better than 10.0 without gapping: 709 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 723 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1363910256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -