BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_H17 (652 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0425 - 17806117-17806401,17806862-17806984,17807076-178072... 27 9.8 05_01_0361 - 2824728-2826043,2826288-2826507,2827616-2827702,282... 27 9.8 03_06_0040 + 31240164-31241102,31241280-31241897 27 9.8 >10_08_0425 - 17806117-17806401,17806862-17806984,17807076-17807222, 17807307-17807450,17808557-17808668,17808762-17808898, 17809016-17809156,17810921-17811004,17811275-17811742, 17811858-17811936,17812494-17812506,17813884-17814460, 17814502-17814774,17814899-17815045,17815354-17815413, 17816124-17816510 Length = 1058 Score = 27.5 bits (58), Expect = 9.8 Identities = 18/76 (23%), Positives = 33/76 (43%) Frame = +2 Query: 26 RFASPPHSVSRQHIMAAKFVVLFACIALAQGAMVRRDAPDFFKDIEHHTKEFHKTLEQQF 205 RF + P S SR+ ++V A + +R A + +K + E H L + Sbjct: 694 RFKAIP-SHSRRRSTFEQYVRTRADEERKEKRAAQRAAVEAYKQLLEEASEGHTILIHKM 752 Query: 206 NSLTKSKDAQDFSKAW 253 + +KD ++F + W Sbjct: 753 QDINSNKDYKEFKRKW 768 >05_01_0361 - 2824728-2826043,2826288-2826507,2827616-2827702, 2827726-2827980,2828704-2828733 Length = 635 Score = 27.5 bits (58), Expect = 9.8 Identities = 18/56 (32%), Positives = 26/56 (46%), Gaps = 2/56 (3%) Frame = +1 Query: 22 SPVRISSALSLSTA--HHGRQVRSSLRLHRSGPRSDGATRRSRLLQGHRTPHQGVP 183 SP R++ L T HH VR +HR+ P+ AT S + +G H +P Sbjct: 473 SPSRVNPVLLCETGQRHHYSSVRHGDPVHRNSPQISVATSPSPIRRGD-PAHINIP 527 >03_06_0040 + 31240164-31241102,31241280-31241897 Length = 518 Score = 27.5 bits (58), Expect = 9.8 Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Frame = +2 Query: 104 ALAQGAMVRRDAPDFFKDIEHHTKEFHKTLEQQFNSLTKSKDAQDFSKA--WKD 259 A+AQ RR+APD D+ +E L+ + N L + + D+ A W D Sbjct: 190 AIAQSKTTRREAPDADTDMSMEAQELRHVLD-ELNPLIGAANLWDYLPALRWFD 242 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,502,287 Number of Sequences: 37544 Number of extensions: 201621 Number of successful extensions: 795 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 783 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 795 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1620349964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -