BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_H14 (651 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g63980.1 68414.m07247 D111/G-patch domain-containing protein ... 30 1.5 At3g49590.2 68416.m05420 expressed protein 29 3.5 At3g49590.1 68416.m05419 expressed protein 29 3.5 At5g49780.1 68418.m06165 leucine-rich repeat transmembrane prote... 28 6.2 At5g02850.1 68418.m00228 hydroxyproline-rich glycoprotein family... 27 8.2 At2g04620.1 68415.m00470 cation efflux family protein potential ... 27 8.2 At1g33260.2 68414.m04112 protein kinase family protein contains ... 27 8.2 At1g33260.1 68414.m04111 protein kinase family protein contains ... 27 8.2 At1g16410.2 68414.m01962 cytochrome P450, putative similar to gb... 27 8.2 At1g16410.1 68414.m01963 cytochrome P450, putative similar to gb... 27 8.2 >At1g63980.1 68414.m07247 D111/G-patch domain-containing protein contains Pfam profile PF01585: G-patch domain Length = 391 Score = 29.9 bits (64), Expect = 1.5 Identities = 18/57 (31%), Positives = 29/57 (50%) Frame = +1 Query: 196 DDDNLKDAVRTYFGKSPSGVYLKSPTPWGDLYKKYKFEQVSRVLSVKSARLKSITKN 366 D +K VR + SGV L P PW + +F+ + + L V++A K+ +KN Sbjct: 37 DKQGIKGYVRVTNKQDTSGVGLDKPNPWA--FDTTQFDNILKKLKVQAAPTKT-SKN 90 >At3g49590.2 68416.m05420 expressed protein Length = 603 Score = 28.7 bits (61), Expect = 3.5 Identities = 16/52 (30%), Positives = 29/52 (55%) Frame = +1 Query: 235 GKSPSGVYLKSPTPWGDLYKKYKFEQVSRVLSVKSARLKSITKNPAIITTQD 390 G+SPSG+ + PT KY + S VLS + + +++P+ +++QD Sbjct: 423 GESPSGLMNQYPTQKLSKDSKYDSGRFSGVLSSSDSPRFAFSRSPSRLSSQD 474 >At3g49590.1 68416.m05419 expressed protein Length = 603 Score = 28.7 bits (61), Expect = 3.5 Identities = 16/52 (30%), Positives = 29/52 (55%) Frame = +1 Query: 235 GKSPSGVYLKSPTPWGDLYKKYKFEQVSRVLSVKSARLKSITKNPAIITTQD 390 G+SPSG+ + PT KY + S VLS + + +++P+ +++QD Sbjct: 423 GESPSGLMNQYPTQKLSKDSKYDSGRFSGVLSSSDSPRFAFSRSPSRLSSQD 474 >At5g49780.1 68418.m06165 leucine-rich repeat transmembrane protein kinase, putative Length = 1006 Score = 27.9 bits (59), Expect = 6.2 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +2 Query: 179 SLSLISTMTI*RMQCERISGRVRP 250 SLSL+ T+T+ R+ R+SG + P Sbjct: 313 SLSLVKTLTVLRLDRNRLSGEIPP 336 >At5g02850.1 68418.m00228 hydroxyproline-rich glycoprotein family protein Length = 426 Score = 27.5 bits (58), Expect = 8.2 Identities = 10/36 (27%), Positives = 20/36 (55%) Frame = +1 Query: 109 GIDNPDITVTYAGVQVDLISEDDVTKFNIDDDNLKD 216 G+ P + VQ+D++ +DD + ++ DD + D Sbjct: 389 GLHRPPDVIQVRAVQLDILEDDDSSDYSSDDASSDD 424 >At2g04620.1 68415.m00470 cation efflux family protein potential member of the cation diffusion facilitator (CDF) family, or cation efflux (CE) family, see PMID:11500563 Length = 798 Score = 27.5 bits (58), Expect = 8.2 Identities = 11/40 (27%), Positives = 20/40 (50%) Frame = +3 Query: 354 HNQEPGYNHYAGL*ERLQ*NDQSEHRYHAHSRKYFNHNMD 473 H + ++ ++ E N EH+ H+H+ + NHN D Sbjct: 595 HEHDHHHHSHSHKHEECNHNHDHEHQSHSHNHEECNHNHD 634 >At1g33260.2 68414.m04112 protein kinase family protein contains Pfam profile: PF00069: Eukaryotic protein kinase domain Length = 348 Score = 27.5 bits (58), Expect = 8.2 Identities = 18/53 (33%), Positives = 24/53 (45%), Gaps = 4/53 (7%) Frame = -1 Query: 288 QIAPWR----WTFQVDSGRTLPEIRSHCILQIVIVDIKLSDVIFGYQVNLHTC 142 Q+ PWR FQV + + I C QIV DIK S+++ N C Sbjct: 133 QVLPWRNRTAIAFQV--AQAIEHIHEKCSPQIVHGDIKSSNILLDKHFNSKLC 183 >At1g33260.1 68414.m04111 protein kinase family protein contains Pfam profile: PF00069: Eukaryotic protein kinase domain Length = 349 Score = 27.5 bits (58), Expect = 8.2 Identities = 18/53 (33%), Positives = 24/53 (45%), Gaps = 4/53 (7%) Frame = -1 Query: 288 QIAPWR----WTFQVDSGRTLPEIRSHCILQIVIVDIKLSDVIFGYQVNLHTC 142 Q+ PWR FQV + + I C QIV DIK S+++ N C Sbjct: 134 QVLPWRNRTAIAFQV--AQAIEHIHEKCSPQIVHGDIKSSNILLDKHFNSKLC 184 >At1g16410.2 68414.m01962 cytochrome P450, putative similar to gb|AF069494 cytochrome P450 from Sinapis alba and is a member of the PF|00067 Cytochrome P450 family Length = 423 Score = 27.5 bits (58), Expect = 8.2 Identities = 16/73 (21%), Positives = 38/73 (52%), Gaps = 3/73 (4%) Frame = +1 Query: 139 YAGVQVDLISEDDVTK--FNIDDDNLKDAVRTYFGKSPSGVYLKSP-TPWGDLYKKYKFE 309 +AG++ I+ D++ + F D +L D + + ++ Y +P+G+ + K K Sbjct: 87 FAGIRAITINSDEIAREAFRERDADLADRPQLFIMETIGDNYKSMGISPYGEQFMKMKRV 146 Query: 310 QVSRVLSVKSARL 348 + ++SVK+ ++ Sbjct: 147 ITTEIMSVKTLKM 159 >At1g16410.1 68414.m01963 cytochrome P450, putative similar to gb|AF069494 cytochrome P450 from Sinapis alba and is a member of the PF|00067 Cytochrome P450 family Length = 538 Score = 27.5 bits (58), Expect = 8.2 Identities = 16/73 (21%), Positives = 38/73 (52%), Gaps = 3/73 (4%) Frame = +1 Query: 139 YAGVQVDLISEDDVTK--FNIDDDNLKDAVRTYFGKSPSGVYLKSP-TPWGDLYKKYKFE 309 +AG++ I+ D++ + F D +L D + + ++ Y +P+G+ + K K Sbjct: 87 FAGIRAITINSDEIAREAFRERDADLADRPQLFIMETIGDNYKSMGISPYGEQFMKMKRV 146 Query: 310 QVSRVLSVKSARL 348 + ++SVK+ ++ Sbjct: 147 ITTEIMSVKTLKM 159 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.316 0.132 0.377 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,225,157 Number of Sequences: 28952 Number of extensions: 230679 Number of successful extensions: 564 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 560 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 563 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1354097952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -