BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_H10 (642 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC18.03 |||shuttle craft like transcriptional regulator|Schizo... 26 4.0 SPAC19A8.10 |rfp1|mug140|ubiquitin-protein ligase E3 Rfp1|Schizo... 26 5.3 SPBC29A10.05 |exo1|mut2|exonuclease I Exo1|Schizosaccharomyces p... 25 9.3 >SPCC18.03 |||shuttle craft like transcriptional regulator|Schizosaccharomyces pombe|chr 3|||Manual Length = 1077 Score = 26.2 bits (55), Expect = 4.0 Identities = 12/51 (23%), Positives = 20/51 (39%), Gaps = 3/51 (5%) Frame = +1 Query: 262 CGN*SNARCXYSNGGTCSTNKTDEXGCEVRDIYAI---RSHGYCSACAKCC 405 CG+ +C + GTCS T C ++ +G+ C + C Sbjct: 485 CGHRCKYKCHLGSCGTCSETLTIPCRCTANEVQVTCEQLQNGFIPTCERLC 535 >SPAC19A8.10 |rfp1|mug140|ubiquitin-protein ligase E3 Rfp1|Schizosaccharomyces pombe|chr 1|||Manual Length = 254 Score = 25.8 bits (54), Expect = 5.3 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +1 Query: 373 HGYCSACAKCCKQISRSQ 426 H YC +CAK K RSQ Sbjct: 214 HVYCGSCAKVLKTSKRSQ 231 >SPBC29A10.05 |exo1|mut2|exonuclease I Exo1|Schizosaccharomyces pombe|chr 2|||Manual Length = 571 Score = 25.0 bits (52), Expect = 9.3 Identities = 12/45 (26%), Positives = 18/45 (40%) Frame = +2 Query: 296 VTEGPVQPIKLTXMDVKSVISMRYAHTAIVAHVRNAANKSQEANF 430 + EG PI D+K + T I R +K+ +NF Sbjct: 321 IAEGRSNPITKCAFDIKDSSMQSFTKTTITISKRKGISKTDISNF 365 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,461,648 Number of Sequences: 5004 Number of extensions: 46384 Number of successful extensions: 119 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 116 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 119 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 287744314 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -