BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_H09 (655 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF164152-1|AAD47076.1| 261|Anopheles gambiae ribosomal protein ... 367 e-103 AY994095-1|AAX86008.1| 144|Anopheles gambiae unknown protein. 27 0.39 AJ439353-4|CAD27926.1| 338|Anopheles gambiae putative hox prote... 25 2.8 AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical prote... 25 2.8 AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical prote... 25 2.8 DQ989013-1|ABK97614.1| 378|Anopheles gambiae gustatory receptor... 24 4.8 AY330177-1|AAQ16283.1| 166|Anopheles gambiae odorant-binding pr... 23 6.4 AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transc... 23 6.4 CR954257-4|CAJ14155.1| 196|Anopheles gambiae predicted protein ... 23 8.4 AJ439060-4|CAD27755.1| 151|Anopheles gambiae putative sRNP prot... 23 8.4 >AF164152-1|AAD47076.1| 261|Anopheles gambiae ribosomal protein L8 protein. Length = 261 Score = 367 bits (903), Expect = e-103 Identities = 167/203 (82%), Positives = 184/203 (90%) Frame = +1 Query: 46 MGRVIRAQRKGAGSVFVSHTKKRKGAPKLRSLHYAERHGYIKGVVKDIIHDPGRGAPLAV 225 MGRVIRAQRKGAGSVF +HTKKRKG PKLR L YAERHGY+KGVVK II DPGRGAPLAV Sbjct: 1 MGRVIRAQRKGAGSVFRAHTKKRKGQPKLRHLDYAERHGYLKGVVKQIIQDPGRGAPLAV 60 Query: 226 VHFRDPYKFKTRKELFIAPEGLYTGQFVYCGKKATLEVGNVMPVGAMPEGTIVCNLEXKM 405 V+FRDPY+F+ K+LFIA EG+YTGQFVYCG++A L++GNV+P+G MPEGTIVCNLE K Sbjct: 61 VNFRDPYRFRLSKQLFIAAEGMYTGQFVYCGRRAQLQIGNVIPIGLMPEGTIVCNLEEKT 120 Query: 406 GDRGRLARASGNFATVIGHNPDAKRTXVKLPSGAKKVLPSSNRGMVGIVAGGGRIDKPIL 585 GDRG+LAR SGN+A+VI HNPD KRT VKLPSGAKKVLPS+NR MVGIVAGGGRIDKPIL Sbjct: 121 GDRGKLARTSGNYASVIAHNPDTKRTRVKLPSGAKKVLPSANRAMVGIVAGGGRIDKPIL 180 Query: 586 KAGRAYHKYKVKRNCWPYVRGVA 654 KAGRAYHKYKVKRNCWP VRGVA Sbjct: 181 KAGRAYHKYKVKRNCWPKVRGVA 203 >AY994095-1|AAX86008.1| 144|Anopheles gambiae unknown protein. Length = 144 Score = 27.5 bits (58), Expect = 0.39 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +1 Query: 523 SSNRGMVGIVAGGGRIDKPILKAGRAYHK 609 S+ + +G V GG D IL GRAYH+ Sbjct: 81 SAGQVPLGAVVGGHTSDGEILYVGRAYHE 109 >AJ439353-4|CAD27926.1| 338|Anopheles gambiae putative hox protein protein. Length = 338 Score = 24.6 bits (51), Expect = 2.8 Identities = 7/15 (46%), Positives = 13/15 (86%) Frame = +3 Query: 525 KQQRHGRYCCWRWTY 569 +QQ+HG++CC R ++ Sbjct: 280 QQQQHGQHCCCRGSH 294 >AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 24.6 bits (51), Expect = 2.8 Identities = 8/16 (50%), Positives = 13/16 (81%) Frame = +1 Query: 154 RHGYIKGVVKDIIHDP 201 R+ +K ++KDI+HDP Sbjct: 737 RYTMLKDMIKDIMHDP 752 >AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 24.6 bits (51), Expect = 2.8 Identities = 8/16 (50%), Positives = 13/16 (81%) Frame = +1 Query: 154 RHGYIKGVVKDIIHDP 201 R+ +K ++KDI+HDP Sbjct: 737 RYTMLKDMIKDIMHDP 752 >DQ989013-1|ABK97614.1| 378|Anopheles gambiae gustatory receptor 24 protein. Length = 378 Score = 23.8 bits (49), Expect = 4.8 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = -2 Query: 426 CQTTSITHFLFKIAHNGTLRHSSNRHHISNFKSCFLSTINKLA 298 C+T SIT + LRH +S ++S +L ++KLA Sbjct: 180 CETLSITAKILAEDFQRALRHVGPAAKVSEYRSLWL-RLSKLA 221 >AY330177-1|AAQ16283.1| 166|Anopheles gambiae odorant-binding protein AgamOBP50 protein. Length = 166 Score = 23.4 bits (48), Expect = 6.4 Identities = 11/44 (25%), Positives = 18/44 (40%) Frame = -2 Query: 318 STINKLACVEPFGSNEELLPCLELVWIAEVYNSQRCTSTRVMDY 187 S + KL C+ PF + ++ C +L + C T Y Sbjct: 8 SVVGKLTCLSPFLQSIKVASCCQLEAFLTLPTYGNCLQTIAEKY 51 >AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transcription factor pannier protein. Length = 537 Score = 23.4 bits (48), Expect = 6.4 Identities = 11/42 (26%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = +1 Query: 55 VIRAQRKGAGSVFVSHTKKRK-GAPKLRSLHYAERHGYIKGV 177 +++ R G K + +P +RSLH + HG G+ Sbjct: 257 LLQTDRNGNSKNLTGSPKSQNLSSPTIRSLHISPHHGQSYGL 298 >CR954257-4|CAJ14155.1| 196|Anopheles gambiae predicted protein protein. Length = 196 Score = 23.0 bits (47), Expect = 8.4 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +3 Query: 219 GCCTLPRSIQVQDKEGALHCSRR 287 GCC LP + Q K+ + + + R Sbjct: 16 GCCALPANTNAQTKQDSSNNNNR 38 >AJ439060-4|CAD27755.1| 151|Anopheles gambiae putative sRNP protein. Length = 151 Score = 23.0 bits (47), Expect = 8.4 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -3 Query: 575 LSIRPPPATIPTM 537 + +RPPP +PTM Sbjct: 114 MGMRPPPMMVPTM 126 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 748,951 Number of Sequences: 2352 Number of extensions: 16635 Number of successful extensions: 34 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 33 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64814025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -