BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_H03 (652 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48657| Best HMM Match : GST_C (HMM E-Value=5.8e-07) 131 4e-31 SB_19860| Best HMM Match : GST_C (HMM E-Value=9.6e-10) 42 6e-04 SB_7437| Best HMM Match : PAS (HMM E-Value=7.2e-14) 31 1.1 SB_45212| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_16159| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_25676| Best HMM Match : TSP_1 (HMM E-Value=0.0055) 29 3.3 SB_51364| Best HMM Match : DUF1431 (HMM E-Value=5.9) 29 4.3 SB_36561| Best HMM Match : BACK (HMM E-Value=1.4013e-45) 28 7.6 SB_32980| Best HMM Match : DEAD (HMM E-Value=0) 28 7.6 >SB_48657| Best HMM Match : GST_C (HMM E-Value=5.8e-07) Length = 203 Score = 131 bits (317), Expect = 4e-31 Identities = 74/163 (45%), Positives = 101/163 (61%) Frame = +1 Query: 34 GLLYTYPENFRAYKALIAAQYSGTDVKVAPNFVFGETNKSEDFLKKFPAGKVPAFESADG 213 G LYTYP++FRA K LIAA+YSGT ++V P F FG+ N + +FLKKFP GKVPAFE+ Sbjct: 4 GKLYTYPDSFRAQKILIAAEYSGTKIEV-PAFTFGKDNHTAEFLKKFPLGKVPAFETK-- 60 Query: 214 KVLLTESNAIAYYVANESLRGGDLATQARVWQWASWSDSELLPASCAWVFPYLGIMQFNK 393 AN R L T + +++D ELLPA+ WVFP G+MQ++K Sbjct: 61 -------------TANACTRAMPLLTT-----YVNFADQELLPAAATWVFPTYGMMQYHK 102 Query: 394 QNVERAKSDLLAALKVLDGHLLTRTFLVTERITLADVIVFSTL 522 Q+ ++A D+ + +L+ LL +TFLV ER+TLAD+ V L Sbjct: 103 QSTDKAMEDVKKYMTMLNDVLLMKTFLVGERVTLADIAVCCVL 145 >SB_19860| Best HMM Match : GST_C (HMM E-Value=9.6e-10) Length = 260 Score = 41.5 bits (93), Expect = 6e-04 Identities = 40/143 (27%), Positives = 63/143 (44%), Gaps = 4/143 (2%) Frame = +1 Query: 175 PAGKVPAFESADGKVLLTESNAIAYYVA--NESLRGGDLATQARVWQWASWSDSELLPAS 348 P +P E+ +G SN I Y+A ++ L G DL + +V QW + + A Sbjct: 45 PFNTLPLLETKEGTFF--SSNTIIRYLAASSDKLYGSDLFQRGQVDQWLDITTCDFEAAV 102 Query: 349 CAWVFPYLGIMQFNKQNVERAK--SDLLAALKVLDGHLLTRTFLVTERITLADVIVFSTL 522 A G ++VE AK +D+ L ++ HL R FLV + +T+AD V +T Sbjct: 103 AAVAIAKEG------RDVEGAKIVADINKFLGFVEKHLAGRKFLVGDSVTIADFSV-ATS 155 Query: 523 LHAFQHVLDPSVRSSLINVQRWF 591 + L R N+ W+ Sbjct: 156 IAVILTSLGDEDRKPYQNIVSWY 178 >SB_7437| Best HMM Match : PAS (HMM E-Value=7.2e-14) Length = 505 Score = 30.7 bits (66), Expect = 1.1 Identities = 18/71 (25%), Positives = 30/71 (42%) Frame = +1 Query: 58 NFRAYKALIAAQYSGTDVKVAPNFVFGETNKSEDFLKKFPAGKVPAFESADGKVLLTESN 237 N +K + Q + K+ P V GE N + +KK +P GK + + + Sbjct: 105 NIGKFKMVWIDQIDESTKKLKPKMVAGEDNGFVNAIKKVSLEDIPEGNGPSGKAIREKRS 164 Query: 238 AIAYYVANESL 270 I + N+SL Sbjct: 165 IIVNDIENDSL 175 >SB_45212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1304 Score = 29.9 bits (64), Expect = 1.9 Identities = 16/48 (33%), Positives = 23/48 (47%) Frame = +1 Query: 358 VFPYLGIMQFNKQNVERAKSDLLAALKVLDGHLLTRTFLVTERITLAD 501 ++P + Q NV+R +DL + K+ L R F V E T AD Sbjct: 73 IYPNIMDEQIRTANVQRGSADLQTSAKITLKKFLPRCFSVIESTTSAD 120 >SB_16159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 351 Score = 29.1 bits (62), Expect = 3.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +1 Query: 280 DLATQARVWQWASWSDSELLPASCA 354 DL T A+V+ WA W ++ SCA Sbjct: 78 DLTTTAQVYSWAMWEPWQMRNLSCA 102 >SB_25676| Best HMM Match : TSP_1 (HMM E-Value=0.0055) Length = 141 Score = 29.1 bits (62), Expect = 3.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +1 Query: 280 DLATQARVWQWASWSDSELLPASCA 354 DL T A+V+ WA W ++ SCA Sbjct: 78 DLTTTAQVYSWAMWEPWQMRNLSCA 102 >SB_51364| Best HMM Match : DUF1431 (HMM E-Value=5.9) Length = 364 Score = 28.7 bits (61), Expect = 4.3 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = -1 Query: 187 LFRQETSSRSLRTCWSRQIRNSVLLSHQSRNIVRRSTLYK 68 +FR + + + S ++ N V +SHQSR IV T+ K Sbjct: 102 VFRSKQQAPNKAVGRSDEVTNEVAVSHQSRRIVESETVRK 141 >SB_36561| Best HMM Match : BACK (HMM E-Value=1.4013e-45) Length = 554 Score = 27.9 bits (59), Expect = 7.6 Identities = 16/45 (35%), Positives = 26/45 (57%) Frame = +1 Query: 376 IMQFNKQNVERAKSDLLAALKVLDGHLLTRTFLVTERITLADVIV 510 +M + K +VE K DL L+ + LLTR FL+ + + D+I+ Sbjct: 194 VMSWIKHDVESRKKDLANLLEHIRFPLLTRKFLI-DTVAKEDLIM 237 >SB_32980| Best HMM Match : DEAD (HMM E-Value=0) Length = 985 Score = 27.9 bits (59), Expect = 7.6 Identities = 11/25 (44%), Positives = 14/25 (56%), Gaps = 2/25 (8%) Frame = +3 Query: 453 SSHTHLPC--YRENHTCRCHCLQYT 521 S +T PC Y+ TC C C+ YT Sbjct: 873 SHYTPFPCPHYQGGPTCECQCMGYT 897 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,240,186 Number of Sequences: 59808 Number of extensions: 492526 Number of successful extensions: 1406 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1275 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1402 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1657237625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -