BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_G24 (650 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL032627-8|CAB63354.2| 373|Caenorhabditis elegans Hypothetical ... 28 6.6 AF000198-6|AAB53056.2| 526|Caenorhabditis elegans Calcium chann... 28 6.6 >AL032627-8|CAB63354.2| 373|Caenorhabditis elegans Hypothetical protein Y41C4A.5 protein. Length = 373 Score = 27.9 bits (59), Expect = 6.6 Identities = 20/66 (30%), Positives = 30/66 (45%) Frame = +3 Query: 225 AGCDALRSSNRGNSKYGSGNQGSREG*TVRRHFPGYTFTEHHKAWCGNICMGNCVLSRGT 404 +G + +++ GNS YGS N GS G + + ++ GN GN + G Sbjct: 206 SGNSSNNNNSSGNSNYGSNNSGSGNGNSNSGNGNSGNGNGNNAGNSGN-GNGNSNGNNGN 264 Query: 405 GSGRNG 422 GS NG Sbjct: 265 GSNGNG 270 >AF000198-6|AAB53056.2| 526|Caenorhabditis elegans Calcium channel, beta subunit protein1 protein. Length = 526 Score = 27.9 bits (59), Expect = 6.6 Identities = 12/46 (26%), Positives = 26/46 (56%) Frame = -3 Query: 255 DLSYAKRRILQYDLKQGQLKTSKSLVSSFLSGVYRSINQLFXICKT 118 D+S AKR +L K+ ++ + S S+ L+ + I ++F + ++ Sbjct: 242 DISLAKRSLLNNPNKRAMMERANSRTSNSLAEIQTEIERIFELARS 287 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,804,197 Number of Sequences: 27780 Number of extensions: 316048 Number of successful extensions: 902 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 880 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 900 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1444744186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -