BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_G23 (504 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 22 3.2 DQ435326-1|ABD92641.1| 132|Apis mellifera OBP9 protein. 22 4.2 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 21 7.3 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 21 9.6 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 22.2 bits (45), Expect = 3.2 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -1 Query: 114 HHRSLGQSDAGEENYELGGHDVL 46 HH+ + AG + L GH VL Sbjct: 920 HHQIQVSTSAGLQTIRLSGHSVL 942 >DQ435326-1|ABD92641.1| 132|Apis mellifera OBP9 protein. Length = 132 Score = 21.8 bits (44), Expect = 4.2 Identities = 19/63 (30%), Positives = 32/63 (50%) Frame = +2 Query: 287 RVSSAALGDANGKAXEALEQSRQNIERTAEELRKAHPDVEKNATALREKLQAAVQNTVQE 466 +VS AAL KA + +EQ QN++ + H ++KNA +K + ++Q+ Sbjct: 34 KVSWAALKKM--KAGD-MEQDDQNLKCYLKCFMTKHGILDKNAEVDVQKALRHLPRSMQD 90 Query: 467 SXK 475 S K Sbjct: 91 STK 93 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 21.0 bits (42), Expect = 7.3 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -2 Query: 251 EPSFQALLKSCASFDLVSELN 189 EP + + ASFD +SE+N Sbjct: 59 EPLLVGMDLTIASFDAISEVN 79 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 20.6 bits (41), Expect = 9.6 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = +3 Query: 48 AHHGRQVRSSLRLHRSGPRSDGATRRSRLLQ 140 A +G+ + LHR+ S + +SRL++ Sbjct: 119 ASNGKIYANHCELHRAACHSGSSLTKSRLMR 149 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 99,935 Number of Sequences: 438 Number of extensions: 1766 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13864083 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -