BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_G20 (463 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g01930.2 68415.m00128 expressed protein 30 0.66 At2g01930.1 68415.m00127 expressed protein 30 0.66 At5g57940.3 68418.m07250 cyclic nucleotide-regulated ion channel... 27 6.2 At5g57940.2 68418.m07249 cyclic nucleotide-regulated ion channel... 27 6.2 At5g57940.1 68418.m07248 cyclic nucleotide-regulated ion channel... 27 6.2 At4g30560.1 68417.m04337 cyclic nucleotide-regulated ion channel... 27 8.2 >At2g01930.2 68415.m00128 expressed protein Length = 283 Score = 30.3 bits (65), Expect = 0.66 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +2 Query: 305 SNXXSQKMKHRPKVSLKALQKNPIPPPAHKKE 400 S S +M H+P ++ ++NPIPPPA +E Sbjct: 94 SGSNSIQMIHQPVLNSSRFEENPIPPPAPCEE 125 >At2g01930.1 68415.m00127 expressed protein Length = 283 Score = 30.3 bits (65), Expect = 0.66 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +2 Query: 305 SNXXSQKMKHRPKVSLKALQKNPIPPPAHKKE 400 S S +M H+P ++ ++NPIPPPA +E Sbjct: 94 SGSNSIQMIHQPVLNSSRFEENPIPPPAPCEE 125 >At5g57940.3 68418.m07250 cyclic nucleotide-regulated ion channel / cyclic nucleotide-gated channel (CNGC5) identical to cyclic nucleotide and calmodulin-regulated ion channel (cngc5) GI:4581205 from [Arabidopsis thaliana] Length = 710 Score = 27.1 bits (57), Expect = 6.2 Identities = 9/27 (33%), Positives = 19/27 (70%) Frame = -3 Query: 131 VTFFTLRSVVGLYYLIYLCVYLRTLFV 51 +T TLR+ + ++YL ++ + LRT ++ Sbjct: 131 ITASTLRTFIDVFYLAHMALQLRTAYI 157 >At5g57940.2 68418.m07249 cyclic nucleotide-regulated ion channel / cyclic nucleotide-gated channel (CNGC5) identical to cyclic nucleotide and calmodulin-regulated ion channel (cngc5) GI:4581205 from [Arabidopsis thaliana] Length = 717 Score = 27.1 bits (57), Expect = 6.2 Identities = 9/27 (33%), Positives = 19/27 (70%) Frame = -3 Query: 131 VTFFTLRSVVGLYYLIYLCVYLRTLFV 51 +T TLR+ + ++YL ++ + LRT ++ Sbjct: 138 ITASTLRTFIDVFYLAHMALQLRTAYI 164 >At5g57940.1 68418.m07248 cyclic nucleotide-regulated ion channel / cyclic nucleotide-gated channel (CNGC5) identical to cyclic nucleotide and calmodulin-regulated ion channel (cngc5) GI:4581205 from [Arabidopsis thaliana] Length = 717 Score = 27.1 bits (57), Expect = 6.2 Identities = 9/27 (33%), Positives = 19/27 (70%) Frame = -3 Query: 131 VTFFTLRSVVGLYYLIYLCVYLRTLFV 51 +T TLR+ + ++YL ++ + LRT ++ Sbjct: 138 ITASTLRTFIDVFYLAHMALQLRTAYI 164 >At4g30560.1 68417.m04337 cyclic nucleotide-regulated ion channel, putative similar to cyclic nucleotide and calmodulin-regulated ion channel cngc6 GI:4581207 from [Arabidopsis thaliana] Length = 733 Score = 26.6 bits (56), Expect = 8.2 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -3 Query: 119 TLRSVVGLYYLIYLCVYLRTLFV 51 TLR+V+ +YL ++ + RT FV Sbjct: 157 TLRTVIDAFYLFHMALRFRTAFV 179 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,657,123 Number of Sequences: 28952 Number of extensions: 150325 Number of successful extensions: 424 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 413 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 424 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 772134480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -