BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_G19 (568 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_20876| Best HMM Match : Ribosomal_S7e (HMM E-Value=0) 159 1e-46 SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) 31 0.66 SB_27572| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.1e-19) 30 1.5 SB_17854| Best HMM Match : RnaseH (HMM E-Value=0.11) 29 3.5 SB_50950| Best HMM Match : AAA_5 (HMM E-Value=0.0006) 28 4.6 SB_43496| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.6 SB_9051| Best HMM Match : Y_phosphatase (HMM E-Value=0) 28 4.6 SB_48206| Best HMM Match : LTXXQ (HMM E-Value=3) 28 6.1 SB_56433| Best HMM Match : Metallophos (HMM E-Value=1.7e-15) 27 8.1 SB_47345| Best HMM Match : Neural_ProG_Cyt (HMM E-Value=8.3) 27 8.1 >SB_20876| Best HMM Match : Ribosomal_S7e (HMM E-Value=0) Length = 157 Score = 159 bits (387), Expect(2) = 1e-46 Identities = 78/120 (65%), Positives = 97/120 (80%) Frame = +1 Query: 19 LKLSTMSTKIIKASGAEADSFETSISQALVELETNSDLKAQLRELYITKAKEIELHNKKS 198 L + T S KI+K G A+ FE ISQA++ELE NSD+KAQLRELYI+ AKEI++ KK+ Sbjct: 2 LAMFTASAKIVKPQGETANEFEQGISQAILELEMNSDMKAQLRELYISSAKEIDVGGKKA 61 Query: 199 IIIYVPMPKLKAFQKIQIRLVRELEKKFSGKHVVFVGDRKILPKPSHKTRVANKQKRPRS 378 III+VP+P+++AFQKIQ RLVRELEKKFSGKHVV V R+ILP+P+ K+R KQKRPRS Sbjct: 62 IIIFVPVPQIRAFQKIQTRLVRELEKKFSGKHVVIVAQRRILPRPTRKSR-NQKQKRPRS 120 Score = 44.8 bits (101), Expect(2) = 1e-46 Identities = 18/26 (69%), Positives = 22/26 (84%) Frame = +1 Query: 490 HLDXNQQTTIEHKVDTFQSVYXKLTG 567 HLD QQTTI+HK++TF +VY KLTG Sbjct: 121 HLDKTQQTTIDHKLETFSTVYKKLTG 146 >SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) Length = 812 Score = 31.1 bits (67), Expect = 0.66 Identities = 26/94 (27%), Positives = 44/94 (46%), Gaps = 8/94 (8%) Frame = +1 Query: 121 NSDLKAQLRELYITKAKEIE---LHNKKSIIIYVPMPKLKAFQKIQIRLVRELEKKFS-- 285 + + K L+E+ I ++K+ E + + KS PKLKA Q + + KK Sbjct: 261 HEEKKEDLKEVVIKQSKQDEATAIKDSKSESKPASKPKLKAVQNDAPKKANKPAKKAKKP 320 Query: 286 ---GKHVVFVGDRKILPKPSHKTRVANKQKRPRS 378 K V+ LP+ +H+ AN Q+RP++ Sbjct: 321 VKRAKKVLNKKKMDTLPRGAHRPASANAQRRPQN 354 >SB_27572| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.1e-19) Length = 3107 Score = 29.9 bits (64), Expect = 1.5 Identities = 36/128 (28%), Positives = 61/128 (47%), Gaps = 5/128 (3%) Frame = +1 Query: 46 IIKASGAEADSFETSISQALVELETNSDLKAQLRE----LYITKAKEIELHNKKSIIIYV 213 ++++SG +S E+ + E N+ LK +L E L +T+ +E E+ N K + +YV Sbjct: 1681 VLESSGGTMNSEESFFLE-----EDNAILKRKLDEKETALKVTQDREREM-NDKLMALYV 1734 Query: 214 PMPKLKAFQKIQIRLVRELEKKFSGKHVVFVGDRKILP-KPSHKTRVANKQKRPRSXTLT 390 M KL++ Q ELEK+ ++ ++I P K S T VA + + Sbjct: 1735 NMSKLESTQGTLEEKNAELEKE------LYSAQQEIQPLKDSFNTAVAENESLVKELNEA 1788 Query: 391 SVYNAILE 414 + N LE Sbjct: 1789 NNKNIKLE 1796 >SB_17854| Best HMM Match : RnaseH (HMM E-Value=0.11) Length = 237 Score = 28.7 bits (61), Expect = 3.5 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = -2 Query: 360 FVSNTSFVAGLRQDLTVSNKDYMFTTE 280 F+ N SFV+ + DLT S+ D+ + TE Sbjct: 40 FIPNLSFVSAVLWDLTKSSSDFQWHTE 66 >SB_50950| Best HMM Match : AAA_5 (HMM E-Value=0.0006) Length = 1552 Score = 28.3 bits (60), Expect = 4.6 Identities = 15/57 (26%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Frame = +1 Query: 73 DSFETSISQALVELETNSDLKAQLRELYITKAKEIELHNKKSIIIYVPM-PKLKAFQ 240 + ++T ++ L + L+ +RELY +E E KKS++ ++ + PK+K + Sbjct: 171 EQWDTILTMIPARLVQSPQLQPYIRELYAEVKQEYEASIKKSMVQHILVKPKVKGVE 227 >SB_43496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 380 Score = 28.3 bits (60), Expect = 4.6 Identities = 22/120 (18%), Positives = 57/120 (47%), Gaps = 8/120 (6%) Frame = +1 Query: 64 AEADSFETSISQALVELETNSDLKAQLRELYITKAKEI-----ELHNKKSIIIYVPMPKL 228 A+ + + Q E++T+ + K +RE ITK K + E +++++ + K+ Sbjct: 237 AQRKTLSDAAKQCSTEIKTSENKKMTIREDMITKRKHVRDRRREHREEETVLRKDELDKV 296 Query: 229 KAFQKIQIRLVRELEKKF---SGKHVVFVGDRKILPKPSHKTRVANKQKRPRSXTLTSVY 399 + + + +RE+E++F K+ + +R++ + K + Q+ + + +V+ Sbjct: 297 AKLYEEEKQDLREMEQEFQNMEAKYNAILEERRLAAEAEKKRQQELVQRNYAAVRIQAVW 356 >SB_9051| Best HMM Match : Y_phosphatase (HMM E-Value=0) Length = 1831 Score = 28.3 bits (60), Expect = 4.6 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +2 Query: 125 PTSKPNFGSFTLQKLKKLNYTIRS 196 P S N+G FT+++LK +YT +S Sbjct: 1415 PLSNDNYGDFTMRRLKVSSYTEQS 1438 >SB_48206| Best HMM Match : LTXXQ (HMM E-Value=3) Length = 513 Score = 27.9 bits (59), Expect = 6.1 Identities = 16/47 (34%), Positives = 20/47 (42%) Frame = -2 Query: 330 LRQDLTVSNKDYMFTTELLFELTDKPDLDLLKGLQFRHRHIDDDRLL 190 LRQ L SN +L L K D+ K +H+ DD LL Sbjct: 170 LRQRLNSSNPSISSPINILDALCQKHDIAYSKSKDLDDKHVADDNLL 216 >SB_56433| Best HMM Match : Metallophos (HMM E-Value=1.7e-15) Length = 417 Score = 27.5 bits (58), Expect = 8.1 Identities = 18/42 (42%), Positives = 22/42 (52%), Gaps = 9/42 (21%) Frame = +2 Query: 104 WSNSKPTPTSKPN--------FG-SFTLQKLKKLNYTIRSRS 202 WS+ KPTP KPN FG T Q L+K N+ + RS Sbjct: 125 WSDPKPTPGCKPNTFRGGGCYFGPDVTSQVLRKHNFELLVRS 166 >SB_47345| Best HMM Match : Neural_ProG_Cyt (HMM E-Value=8.3) Length = 151 Score = 27.5 bits (58), Expect = 8.1 Identities = 11/26 (42%), Positives = 21/26 (80%) Frame = +1 Query: 211 VPMPKLKAFQKIQIRLVRELEKKFSG 288 VP+P++ A QK++ +L R++E+K +G Sbjct: 69 VPLPQVSAMQKVKGKL-RDMEQKLNG 93 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,599,025 Number of Sequences: 59808 Number of extensions: 288248 Number of successful extensions: 824 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 755 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 823 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1337207630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -