BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_G16 (612 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_04_0339 + 22135922-22136698 28 5.1 >02_04_0339 + 22135922-22136698 Length = 258 Score = 28.3 bits (60), Expect = 5.1 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -2 Query: 161 DPLDDLITQYLDVSW-ITFRAASKATFCLILLISFNMADRF 42 D LD LIT Y++ SW + K T I+L + D+F Sbjct: 149 DQLDQLITAYIEASWDPVISSFEKRTQVAIILWPHQLFDKF 189 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.312 0.129 0.359 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,960,907 Number of Sequences: 37544 Number of extensions: 245591 Number of successful extensions: 333 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 327 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 333 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1466594128 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits)
- SilkBase 1999-2023 -