BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_G12 (650 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g17530.1 68417.m02622 Ras-related GTP-binding protein, putati... 27 8.2 At4g12570.1 68417.m01983 ubiquitin-protein ligase, putative simi... 27 8.2 >At4g17530.1 68417.m02622 Ras-related GTP-binding protein, putative very strong similarity to RAB1C [Lotus corniculatus var. japonicus] GI:1370166; contains Pfam profile PF00071: Ras family Length = 202 Score = 27.5 bits (58), Expect = 8.2 Identities = 14/48 (29%), Positives = 26/48 (54%) Frame = -1 Query: 272 VLISNECTLQNNQIGIAETIKAFP*KRADDFVDTFRLKSCNNNSSSFV 129 +L+ N+C L + ++ ET KAF + F++T K+ N +F+ Sbjct: 117 LLVGNKCDLTSQKVVSTETAKAFADELGIPFLET-SAKNATNVEEAFM 163 >At4g12570.1 68417.m01983 ubiquitin-protein ligase, putative similar to SP|P39940 Ubiquitin--protein ligase RSP5 (EC 6.3.2.-) {Saccharomyces cerevisiae}; contains Pfam profiles PF00240: Ubiquitin family, PF00632: HECT-domain (ubiquitin-transferase) Length = 873 Score = 27.5 bits (58), Expect = 8.2 Identities = 15/49 (30%), Positives = 22/49 (44%) Frame = -1 Query: 248 LQNNQIGIAETIKAFP*KRADDFVDTFRLKSCNNNSSSFVKALLFFPDI 102 L N++ + + F KR DD F K N + A+L FPD+ Sbjct: 456 LNKNKVSFSALVVKFA-KRGDDHQWIFEYKEATNFEARRHLAMLLFPDV 503 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,617,275 Number of Sequences: 28952 Number of extensions: 233220 Number of successful extensions: 515 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 509 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 515 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1354097952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -