BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_G09 (598 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC106.07c |||N alpha-acetyltransferase Nat2 |Schizosaccharomyc... 27 1.6 SPAC2F3.11 |||exopolyphosphatase |Schizosaccharomyces pombe|chr ... 26 3.6 SPAC13A11.01c |rga8|SPAC2F7.18c|GTPase activating protein Rga8 |... 26 3.6 SPBP19A11.07c ||SPBP4H10.02c|human down-regulated in multiple ca... 25 8.4 SPAC2F7.11 |nrd1|msa2|RNA-binding protein Nrd1|Schizosaccharomyc... 25 8.4 >SPBC106.07c |||N alpha-acetyltransferase Nat2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 167 Score = 27.5 bits (58), Expect = 1.6 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = -3 Query: 359 RNIEGMRLSTQTAPTFSIFSPPYRRDL 279 RN++ +RL + APT +++ P RR + Sbjct: 6 RNLKSVRLPFRRAPTLPLYNVPVRRSI 32 >SPAC2F3.11 |||exopolyphosphatase |Schizosaccharomyces pombe|chr 1|||Manual Length = 384 Score = 26.2 bits (55), Expect = 3.6 Identities = 18/61 (29%), Positives = 28/61 (45%) Frame = -3 Query: 359 RNIEGMRLSTQTAPTFSIFSPPYRRDLHQVHI*DVFALCLYQQGFFLIVHPTSAVPPTQL 180 RN+ + +AP+FS S DL V+A CL ++ IV P +P +L Sbjct: 15 RNLLLNASTVSSAPSFSFVSGNESADLDSCASSIVYAYCLQRKQLGRIVVPFFNIPRKEL 74 Query: 179 K 177 + Sbjct: 75 R 75 >SPAC13A11.01c |rga8|SPAC2F7.18c|GTPase activating protein Rga8 |Schizosaccharomyces pombe|chr 1|||Manual Length = 777 Score = 26.2 bits (55), Expect = 3.6 Identities = 16/52 (30%), Positives = 22/52 (42%) Frame = -3 Query: 218 IVHPTSAVPPTQLKRDTYIHQ*KLYSSFQNDXSFVLSVIDARTIYNRVIMGL 63 +V A+P YI KLYSS V+DA IY+ ++ L Sbjct: 303 LVENAKALPLVGEYLSDYISHRKLYSSETQSQRLKREVLDANKIYSESVVDL 354 >SPBP19A11.07c ||SPBP4H10.02c|human down-regulated in multiple cancers-1 homolog 2|Schizosaccharomyces pombe|chr 2|||Manual Length = 676 Score = 25.0 bits (52), Expect = 8.4 Identities = 20/85 (23%), Positives = 42/85 (49%), Gaps = 4/85 (4%) Frame = -2 Query: 282 PSPSAHLRCLCIVPLSARVFSNCASDICGAANTVKTRHVHTPMKTIFFISK-*YXVRAVR 106 PSPS+ LC + + + N S+I + T+ ++ ++ I ++ K + +++ + Sbjct: 432 PSPSSQFPVLCTLENPSSIEYNIISNILFSIPTIPLKNASPIVELISYVMKPEFFMKSQQ 491 Query: 105 NR--C*NHLQS-SYYGIKNISNRLN 40 N C L S Y+ I N ++ L+ Sbjct: 492 NASDCKKLLSSFLYFLINNFNDNLH 516 >SPAC2F7.11 |nrd1|msa2|RNA-binding protein Nrd1|Schizosaccharomyces pombe|chr 1|||Manual Length = 529 Score = 25.0 bits (52), Expect = 8.4 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = -3 Query: 380 ECAATPARNIEGMRLSTQTAPTFSIFSPPY 291 + AA PA G +S T+P + F+P Y Sbjct: 74 QMAAAPAHPTTGYNVSRVTSPNVANFAPGY 103 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,390,453 Number of Sequences: 5004 Number of extensions: 48813 Number of successful extensions: 90 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 88 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 90 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 260219058 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -