BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_G08 (467 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 25 1.7 CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein ... 23 5.3 AY176050-1|AAO19581.1| 522|Anopheles gambiae cytochrome P450 CY... 23 5.3 AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. 23 5.3 M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles ... 23 7.0 AY193727-1|AAO24698.1| 492|Anopheles gambiae cytochrome P450 pr... 23 7.0 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 24.6 bits (51), Expect = 1.7 Identities = 11/38 (28%), Positives = 21/38 (55%) Frame = +1 Query: 82 CGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKP 195 CG K++ +DP E+ +R+M K+ ++ K+P Sbjct: 1179 CGSKQLDIDP---QEVVGGAGACGVRRMAKEKMLRKRP 1213 >CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein protein. Length = 1087 Score = 23.0 bits (47), Expect = 5.3 Identities = 7/20 (35%), Positives = 12/20 (60%) Frame = +2 Query: 209 PAPVSAKTQRHVERVVTVAL 268 P P+ KT H+E++ + L Sbjct: 59 PNPLEQKTNAHIEKIFLITL 78 >AY176050-1|AAO19581.1| 522|Anopheles gambiae cytochrome P450 CYP12F2 protein. Length = 522 Score = 23.0 bits (47), Expect = 5.3 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +1 Query: 133 NTNSRQNIRKMIKDGLVIKKPVAVHSRARVR 225 N ++ +R IK+GL + +PVA + RA R Sbjct: 370 NMHNLPYLRACIKEGLRMYQPVAGNMRAAGR 400 >AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. Length = 1133 Score = 23.0 bits (47), Expect = 5.3 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = +2 Query: 17 DLTVSG*VPSSCRRGLQPLLCDVVKR 94 +LT+ VP+ C G Q +C ++K+ Sbjct: 1107 ELTIHRYVPARCGAGCQDRVCILLKK 1132 >M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 442 Score = 22.6 bits (46), Expect = 7.0 Identities = 7/15 (46%), Positives = 12/15 (80%) Frame = -1 Query: 176 PSLIILRMFCLELVF 132 PSL++ R FC ++V+ Sbjct: 4 PSLLLFRQFCRDIVW 18 >AY193727-1|AAO24698.1| 492|Anopheles gambiae cytochrome P450 protein. Length = 492 Score = 22.6 bits (46), Expect = 7.0 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +2 Query: 251 VVTVALVREEVLPMRVCHR 307 V TV + E+ PMRV HR Sbjct: 473 VATVVVTPEDGFPMRVEHR 491 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 519,091 Number of Sequences: 2352 Number of extensions: 10388 Number of successful extensions: 18 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 40820256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -