BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_G07 (626 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC6F12.16c |mtr4||ATP-dependent RNA helicase, TRAMP complex su... 26 5.1 SPBP23A10.13 |orc4|orp4|origin recognition complex subunit Orc4|... 25 6.8 SPBC25D12.02c |dnt1||nucleolar protein Dnt1|Schizosaccharomyces ... 25 9.0 SPAC31G5.10 |eta2||Myb family transcriptional regulator Eta2|Sch... 25 9.0 >SPAC6F12.16c |mtr4||ATP-dependent RNA helicase, TRAMP complex subunit Mtr4|Schizosaccharomyces pombe|chr 1|||Manual Length = 1117 Score = 25.8 bits (54), Expect = 5.1 Identities = 17/45 (37%), Positives = 25/45 (55%) Frame = +1 Query: 127 SDDGSTVVEKKGRGRPKANGTQPESKELKKRGRPPAATRTKDSAK 261 SD VV++K R + N + S ++K+G PAA TK +AK Sbjct: 384 SDGIHLVVDEKSNFREE-NFQRAMSALMEKQGDDPAAMATKGNAK 427 >SPBP23A10.13 |orc4|orp4|origin recognition complex subunit Orc4|Schizosaccharomyces pombe|chr 2|||Manual Length = 972 Score = 25.4 bits (53), Expect = 6.8 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +1 Query: 169 RPKANGTQPESKELKKRGRPPAATRTKDSAKSSD 270 +P G++P K +KRGRPP + S K D Sbjct: 112 KPIDEGSEPIIK--RKRGRPPKIKSSSPSTKLDD 143 Score = 25.4 bits (53), Expect = 6.8 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 5/37 (13%) Frame = +1 Query: 130 DDGSTVVEKKGRGR-PKANGTQPESK---ELK-KRGR 225 D+GS + K+ RGR PK + P +K LK KRGR Sbjct: 115 DEGSEPIIKRKRGRPPKIKSSSPSTKLDDPLKPKRGR 151 >SPBC25D12.02c |dnt1||nucleolar protein Dnt1|Schizosaccharomyces pombe|chr 2|||Manual Length = 599 Score = 25.0 bits (52), Expect = 9.0 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +2 Query: 179 PMEHNLSRKNLKNEVGLQLPPE 244 P E N++ +N+KNE +P E Sbjct: 45 PFESNINIRNIKNEESYDIPNE 66 >SPAC31G5.10 |eta2||Myb family transcriptional regulator Eta2|Schizosaccharomyces pombe|chr 1|||Manual Length = 569 Score = 25.0 bits (52), Expect = 9.0 Identities = 13/77 (16%), Positives = 38/77 (49%), Gaps = 2/77 (2%) Frame = +2 Query: 179 PMEHNLSRKNLKNEVGLQLPPE--QKILLSLLMMNKHXXLNEVEADQKVPRKKRESRARV 352 P +++ ++ ++G + P ++ ++ + + E + ++ RKK++S+ + Sbjct: 429 PASDSIAWHSISKKLGTKSPESCRKQYEKTIASYSSNQRQEEDQGKKRKKRKKKKSKGKR 488 Query: 353 KVEVVDGHAKMHHLQKK 403 K V D + H+Q++ Sbjct: 489 KFYVADSLKLLEHVQRQ 505 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,121,169 Number of Sequences: 5004 Number of extensions: 37448 Number of successful extensions: 113 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 111 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 113 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 277683324 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -