BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_G04 (651 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC26A3.01 |sxa1|SPAC2E1P5.06|aspartic protease Sxa1 |Schizosac... 31 0.19 SPBC19G7.09 |ulp1||SUMO deconjugating enzyme Ulp1|Schizosaccharo... 27 3.1 SPBC405.06 |||DNAJ protein Xdj1 |Schizosaccharomyces pombe|chr 2... 27 3.1 SPAC17C9.07 |alg8||glucosyltransferase Alg8|Schizosaccharomyces ... 26 4.1 SPBC3F6.04c |||U3 snoRNP protein Nop14 |Schizosaccharomyces pomb... 26 4.1 SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosac... 25 7.2 SPCC613.10 |qcr2||ubiquinol-cytochrome-c reductase complex core ... 25 9.5 SPBC776.15c |||dihydrolipoamide S-succinyltransferase, e2 compon... 25 9.5 >SPAC26A3.01 |sxa1|SPAC2E1P5.06|aspartic protease Sxa1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 533 Score = 30.7 bits (66), Expect = 0.19 Identities = 27/92 (29%), Positives = 43/92 (46%), Gaps = 6/92 (6%) Frame = +3 Query: 165 ALIASSVMALYRVPLHR---MKTARTHFHEVGTELELLRL--KYDVTGPSPEPLSNYLDA 329 AL AS A VP R + + + V +LE ++ K D +G L Y DA Sbjct: 15 ALQASVASAYSEVPGKRSVVLNLQHSQYDHVARKLERTKVLNKRDSSGYPVLDLE-YTDA 73 Query: 330 Q-YYGVISIGTPPQSFKVVFDTGSSNLWVPSK 422 Y+ +++G+ + + + DTGS WV +K Sbjct: 74 GGYFANLTLGSNERVYSLTLDTGSPYTWVTAK 105 >SPBC19G7.09 |ulp1||SUMO deconjugating enzyme Ulp1|Schizosaccharomyces pombe|chr 2|||Manual Length = 568 Score = 26.6 bits (56), Expect = 3.1 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 3/50 (6%) Frame = -3 Query: 628 SPGSDTASANVWRRTLSPPTVTSSVER---KPERLPEPYCIANWVPFATY 488 SP SDT S N+ LSP + S R +P R + ++N + A + Sbjct: 143 SPASDTHSQNIHDEALSPSSFRVSRSRYFPRPHRSSKNLSVSNRLQLAVF 192 >SPBC405.06 |||DNAJ protein Xdj1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 413 Score = 26.6 bits (56), Expect = 3.1 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -2 Query: 425 LFGRHPEVGGSGVEYHLERLRRRADTDHSVVLSIK 321 +FG + E GG G +R RR +D H +S++ Sbjct: 95 MFGMNFEAGGPGKNVPRDRKRRGSDVIHDYEISLE 129 >SPAC17C9.07 |alg8||glucosyltransferase Alg8|Schizosaccharomyces pombe|chr 1|||Manual Length = 501 Score = 26.2 bits (55), Expect = 4.1 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +3 Query: 138 MGKISLFFLALIASSVMALYRVPLHRMKTARTH 236 MGK+S+ + A IAS+ + ++ P +R H Sbjct: 1 MGKLSMLYNAAIASTFVKVFLFPSYRSTDFEVH 33 >SPBC3F6.04c |||U3 snoRNP protein Nop14 |Schizosaccharomyces pombe|chr 2|||Manual Length = 827 Score = 26.2 bits (55), Expect = 4.1 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -2 Query: 641 GHEGKPGLRHGLGERL 594 G EGKPG+ G+GE L Sbjct: 72 GTEGKPGVSRGVGEEL 87 >SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosaccharomyces pombe|chr 1|||Manual Length = 2363 Score = 25.4 bits (53), Expect = 7.2 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = +1 Query: 100 ISKSPSCGF*KQQWERYLYF 159 + K P CGF W +L+F Sbjct: 644 VGKGPGCGFWAPSWRVWLFF 663 >SPCC613.10 |qcr2||ubiquinol-cytochrome-c reductase complex core protein Qcr2|Schizosaccharomyces pombe|chr 3|||Manual Length = 426 Score = 25.0 bits (52), Expect = 9.5 Identities = 16/49 (32%), Positives = 27/49 (55%) Frame = +3 Query: 288 TGPSPEPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHY 434 +GP + S+ L A+Y+ VI G+P +S +G S ++ SK +Y Sbjct: 204 SGPDVQKASD-LCAKYFAVIPDGSPLKSAPTKISSGESRVY--SKGTNY 249 >SPBC776.15c |||dihydrolipoamide S-succinyltransferase, e2 component of oxoglutarate dehydrogenase complex |Schizosaccharomyces pombe|chr 2|||Manual Length = 452 Score = 25.0 bits (52), Expect = 9.5 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +3 Query: 267 LRLKYDVTGPSPEPLSNYLDAQYYGVISIGTPP 365 LR Y VT P + ++N L A+Y I TPP Sbjct: 18 LRSGYSVTAPVSKSMANVLWARYAST-RIKTPP 49 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,511,844 Number of Sequences: 5004 Number of extensions: 50228 Number of successful extensions: 152 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 144 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 152 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 293780908 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -