BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_G04 (651 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-7|CAD27929.1| 555|Anopheles gambiae putative glycerol ... 25 2.7 AY063776-1|AAL59658.1| 224|Anopheles gambiae glutathione S-tran... 23 6.3 AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 23 6.3 >AJ439353-7|CAD27929.1| 555|Anopheles gambiae putative glycerol kinase protein. Length = 555 Score = 24.6 bits (51), Expect = 2.7 Identities = 14/54 (25%), Positives = 25/54 (46%) Frame = -3 Query: 622 GSDTASANVWRRTLSPPTVTSSVERKPERLPEPYCIANWVPFATYVLDLRLSYL 461 G +A VW + TV + R PE+ + + +P + Y L+L++L Sbjct: 102 GEPLYNAIVWNDIRTDKTVDRVLARLPEQNHNHFRALSGLPISPYFSALKLNWL 155 >AY063776-1|AAL59658.1| 224|Anopheles gambiae glutathione S-transferase E1 protein. Length = 224 Score = 23.4 bits (48), Expect = 6.3 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -2 Query: 431 VALFGRHPEVGGSGVEYHLERLRRRADT 348 +A+FGR PE+ +EY + R D+ Sbjct: 120 LAIFGRKPEIPEDRIEYVRKAYRLLEDS 147 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 23.4 bits (48), Expect = 6.3 Identities = 8/19 (42%), Positives = 8/19 (42%) Frame = +1 Query: 571 WAGSRCGARRSPRPCRSPG 627 W G C R S C PG Sbjct: 622 WTGPACDCRASNETCMPPG 640 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 655,814 Number of Sequences: 2352 Number of extensions: 13610 Number of successful extensions: 35 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 33 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 35 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64395870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -