BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_F23 (652 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 22 4.5 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 22 5.9 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 22.2 bits (45), Expect = 4.5 Identities = 16/61 (26%), Positives = 29/61 (47%) Frame = +3 Query: 108 RTLSLVMRCSLTLTK*NWSMKLFTK*PVGW*REHRADIQIEGFNPSAEEADEGTDSAVES 287 +TL+ V++ + K N++ L +G + D+++EGF D T S +S Sbjct: 1018 KTLNEVLQADMNALK-NFNQPLLVNDQLG---QLYLDLEVEGFETKLVLEDGITSSGSDS 1073 Query: 288 G 290 G Sbjct: 1074 G 1074 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 21.8 bits (44), Expect = 5.9 Identities = 9/35 (25%), Positives = 22/35 (62%) Frame = -2 Query: 159 NFIL*VSENISSPVIMSL*IFILMDWRRLKIIKTE 55 +F+L VS I++ V + IF+ + W + ++++ + Sbjct: 230 SFLLYVSGFITTEVAGTYAIFLYISWHQKELVRRD 264 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 157,227 Number of Sequences: 438 Number of extensions: 3209 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19682733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -