BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_F20 (651 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ850294-1|CAH64514.1| 539|Tribolium castaneum putative esteras... 22 5.0 AJ850293-1|CAH64513.1| 539|Tribolium castaneum putative esteras... 22 5.0 AJ850292-1|CAH64512.1| 539|Tribolium castaneum putative esteras... 22 5.0 AM292366-1|CAL23178.2| 379|Tribolium castaneum gustatory recept... 21 8.8 AM292329-1|CAL23141.2| 379|Tribolium castaneum gustatory recept... 21 8.8 >AJ850294-1|CAH64514.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 21.8 bits (44), Expect = 5.0 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 631 IQGVPVFVSFTIQNGLRYSDVGPSNQLV 548 + VP SFT GL + D +NQL+ Sbjct: 310 VYDVPWIASFTKSEGLYHLDEVYNNQLL 337 >AJ850293-1|CAH64513.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 21.8 bits (44), Expect = 5.0 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 631 IQGVPVFVSFTIQNGLRYSDVGPSNQLV 548 + VP SFT GL + D +NQL+ Sbjct: 310 VYDVPWIASFTKSEGLYHLDEVYNNQLL 337 >AJ850292-1|CAH64512.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 21.8 bits (44), Expect = 5.0 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 631 IQGVPVFVSFTIQNGLRYSDVGPSNQLV 548 + VP SFT GL + D +NQL+ Sbjct: 310 VYDVPWIASFTKSEGLYHLDEVYNNQLL 337 >AM292366-1|CAL23178.2| 379|Tribolium castaneum gustatory receptor candidate 45 protein. Length = 379 Score = 21.0 bits (42), Expect = 8.8 Identities = 9/34 (26%), Positives = 14/34 (41%) Frame = +2 Query: 527 DECSFTMDELIAWTHITIPQAVLNGETHEXWYPL 628 D C+ + I+W + Q V N E + L Sbjct: 299 DACTIASKQTISWCYKLQEQFVTNSEVRTELFKL 332 >AM292329-1|CAL23141.2| 379|Tribolium castaneum gustatory receptor candidate 8 protein. Length = 379 Score = 21.0 bits (42), Expect = 8.8 Identities = 9/34 (26%), Positives = 14/34 (41%) Frame = +2 Query: 527 DECSFTMDELIAWTHITIPQAVLNGETHEXWYPL 628 D C+ + I+W + Q V N E + L Sbjct: 299 DACTIASKQTISWCYKLQEQFVTNSEVRTELFKL 332 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 147,090 Number of Sequences: 336 Number of extensions: 3130 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16760905 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -