BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_F17 (582 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. 25 0.62 U77974-1|AAB36556.1| 276|Tribolium castaneum transcription fact... 23 2.5 >DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. Length = 305 Score = 24.6 bits (51), Expect = 0.62 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +1 Query: 469 EPLYTLALPFSFRWTRSFTLILQAYDDYXYSEPEA 573 E L TLA+ +W L+ + +D+ Y PE+ Sbjct: 16 EKLNTLAISVMNQWPGVRLLVTEGWDEEGYHTPES 50 >U77974-1|AAB36556.1| 276|Tribolium castaneum transcription factor homolog protein. Length = 276 Score = 22.6 bits (46), Expect = 2.5 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -3 Query: 100 HTQPGPSAHTXWHARTDSSALHVRPPP 20 +T P +A + +HA S LH PPP Sbjct: 141 YTDPAFAA-SIFHAAATSLPLHYPPPP 166 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 75,903 Number of Sequences: 336 Number of extensions: 959 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14517299 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -