BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_F15 (475 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein pr... 26 0.58 AY146747-1|AAO12062.1| 288|Anopheles gambiae odorant-binding pr... 25 1.8 AJ618931-1|CAF02009.1| 288|Anopheles gambiae odorant-binding pr... 25 1.8 >AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein protein. Length = 476 Score = 26.2 bits (55), Expect = 0.58 Identities = 17/62 (27%), Positives = 33/62 (53%), Gaps = 2/62 (3%) Frame = -2 Query: 300 EHQKRGEMTPHLFSLPVRFTTILPA--L*SSTISNSPM*PCFIITVKNLTMTLEXGPDED 127 E+ + G+M HLF + F++++ A S++ + + + +LT TLE D+D Sbjct: 107 EYDESGDMEAHLFRMDELFSSLMNAGQELDSSLKVAMVLKSMPESYDHLTTTLETRSDDD 166 Query: 126 LS 121 L+ Sbjct: 167 LT 168 >AY146747-1|AAO12062.1| 288|Anopheles gambiae odorant-binding protein AgamOBP42 protein. Length = 288 Score = 24.6 bits (51), Expect = 1.8 Identities = 10/23 (43%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = +3 Query: 264 TSVVSFHL-VFDVPINDIERWTN 329 T + F L V D+P +D E+WT+ Sbjct: 154 TETMHFCLDVLDIPFSDFEQWTS 176 >AJ618931-1|CAF02009.1| 288|Anopheles gambiae odorant-binding protein OBPjj83d protein. Length = 288 Score = 24.6 bits (51), Expect = 1.8 Identities = 10/23 (43%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = +3 Query: 264 TSVVSFHL-VFDVPINDIERWTN 329 T + F L V D+P +D E+WT+ Sbjct: 154 TETMHFCLDVLDIPFSDFEQWTS 176 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 416,869 Number of Sequences: 2352 Number of extensions: 6936 Number of successful extensions: 19 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 41670678 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -