BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_F14 (654 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 23 2.2 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 23 2.2 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 23 2.2 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 23 2.2 AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 22 3.8 AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory recept... 21 6.7 AM292335-1|CAL23147.2| 374|Tribolium castaneum gustatory recept... 21 6.7 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 23.0 bits (47), Expect = 2.2 Identities = 9/43 (20%), Positives = 22/43 (51%) Frame = -3 Query: 538 LLYSGQXSXF*VXHHAEISHCLVPIEFVLFLSFXCKAFCEILV 410 +L + F + + + ++PI F + + F CK+ +++V Sbjct: 930 MLVGAFVAAFQIDNWTSFYYNIIPILFFMLVCFTCKSNIQLIV 972 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 23.0 bits (47), Expect = 2.2 Identities = 9/43 (20%), Positives = 22/43 (51%) Frame = -3 Query: 538 LLYSGQXSXF*VXHHAEISHCLVPIEFVLFLSFXCKAFCEILV 410 +L + F + + + ++PI F + + F CK+ +++V Sbjct: 930 MLVGAFVAAFQIDNWTSFYYNIIPILFFMLVCFTCKSNIQLIV 972 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 23.0 bits (47), Expect = 2.2 Identities = 9/43 (20%), Positives = 22/43 (51%) Frame = -3 Query: 538 LLYSGQXSXF*VXHHAEISHCLVPIEFVLFLSFXCKAFCEILV 410 +L + F + + + ++PI F + + F CK+ +++V Sbjct: 930 MLVGAFVAAFQIDNWTSFYYNIIPILFFMLVCFTCKSNIQLIV 972 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 23.0 bits (47), Expect = 2.2 Identities = 9/43 (20%), Positives = 22/43 (51%) Frame = -3 Query: 538 LLYSGQXSXF*VXHHAEISHCLVPIEFVLFLSFXCKAFCEILV 410 +L + F + + + ++PI F + + F CK+ +++V Sbjct: 930 MLVGAFVAAFQIDNWTSFYYNIIPILFFMLVCFTCKSNIQLIV 972 >AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 protein protein. Length = 301 Score = 22.2 bits (45), Expect = 3.8 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -2 Query: 641 APRRCTINTNSLTKAAAXSPS 579 +P +IN N+ T ++A SPS Sbjct: 155 SPTPVSINNNTSTSSSASSPS 175 >AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory receptor candidate 49 protein. Length = 418 Score = 21.4 bits (43), Expect = 6.7 Identities = 7/19 (36%), Positives = 14/19 (73%) Frame = +3 Query: 99 SIKNVFDLQRLHWLLSSFT 155 S++ + +L LH+ L++FT Sbjct: 253 SVQKIQELSHLHYKLANFT 271 >AM292335-1|CAL23147.2| 374|Tribolium castaneum gustatory receptor candidate 14 protein. Length = 374 Score = 21.4 bits (43), Expect = 6.7 Identities = 7/19 (36%), Positives = 14/19 (73%) Frame = +3 Query: 99 SIKNVFDLQRLHWLLSSFT 155 S++ + +L LH+ L++FT Sbjct: 209 SVQKIQELSHLHYKLANFT 227 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 126,085 Number of Sequences: 336 Number of extensions: 2355 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16865010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -