BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_F14 (654 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 22 6.0 DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protei... 22 6.0 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 22 6.0 M29491-1|AAA27726.1| 79|Apis mellifera protein ( Bee homeobox-... 21 7.9 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 21.8 bits (44), Expect = 6.0 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 366 PTLRSSYIQILIGIHTRIS 422 P Y+Q++ +HTRIS Sbjct: 316 PLHMQKYVQMIHDLHTRIS 334 >DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protein protein. Length = 424 Score = 21.8 bits (44), Expect = 6.0 Identities = 6/16 (37%), Positives = 14/16 (87%) Frame = +1 Query: 196 LITKILKKSKCDISLI 243 L+ ++++ +KCD+SL+ Sbjct: 402 LVDELVRGTKCDVSLL 417 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 21.8 bits (44), Expect = 6.0 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 366 PTLRSSYIQILIGIHTRIS 422 P Y+Q++ +HTRIS Sbjct: 316 PLHMQKYVQMIHDLHTRIS 334 >M29491-1|AAA27726.1| 79|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone H17. ). Length = 79 Score = 21.4 bits (43), Expect = 7.9 Identities = 10/41 (24%), Positives = 19/41 (46%) Frame = -2 Query: 164 MRRGKGRQKPM*PLQVEYIFNGSFKLKRFQYIVMKFRVGIS 42 +R+ K +KP P + + + K + QY+ + R S Sbjct: 3 LRKHKPNRKPRTPFTTQQLLSLEKKFREKQYLTIAERAEFS 43 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 147,625 Number of Sequences: 438 Number of extensions: 2757 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19804986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -