BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_F12 (652 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 23 2.6 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 22 4.5 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 22 4.5 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 21 7.8 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 23.0 bits (47), Expect = 2.6 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +3 Query: 186 IKDTFLYFAYGSNLFKKRIRINNPTAEFLGVGRLDNHQL 302 + T+ F Y S K+ +R ++ + GV LDNH + Sbjct: 243 VAGTYAIFLYISWHQKELVRRDSRRKNYGGVYHLDNHHV 281 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 22.2 bits (45), Expect = 4.5 Identities = 8/18 (44%), Positives = 14/18 (77%) Frame = -1 Query: 220 LPYAKYKKVSLIGSIILR 167 LPY KYK +++I ++ +R Sbjct: 318 LPYYKYKYLNVINALEMR 335 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 22.2 bits (45), Expect = 4.5 Identities = 8/18 (44%), Positives = 14/18 (77%) Frame = -1 Query: 220 LPYAKYKKVSLIGSIILR 167 LPY KYK +++I ++ +R Sbjct: 318 LPYYKYKYLNVINALEMR 335 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 21.4 bits (43), Expect = 7.8 Identities = 6/17 (35%), Positives = 10/17 (58%) Frame = -1 Query: 397 CSLHIAPQTWACSVGII 347 CS+ +A W C+ I+ Sbjct: 138 CSIWLAVDVWMCTASIL 154 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,694 Number of Sequences: 438 Number of extensions: 3317 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19682733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -