BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_F04 (443 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81521-2|CAB04224.1| 514|Caenorhabditis elegans Hypothetical pr... 27 8.1 AF076840-1|AAC95522.1| 514|Caenorhabditis elegans Rad17-like pr... 27 8.1 >Z81521-2|CAB04224.1| 514|Caenorhabditis elegans Hypothetical protein F32A11.2 protein. Length = 514 Score = 26.6 bits (56), Expect = 8.1 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = +1 Query: 172 LKTKEDADPTKQKTKSFMVSWKKIPHLFLPKNFYCPEVNSTAY 300 ++T+ + DPT T S M S K + LF + +C ++ Y Sbjct: 295 VRTELEHDPTDIITMSSMTSEKLLDFLFQNEPIFCSNISKYRY 337 >AF076840-1|AAC95522.1| 514|Caenorhabditis elegans Rad17-like protein protein. Length = 514 Score = 26.6 bits (56), Expect = 8.1 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = +1 Query: 172 LKTKEDADPTKQKTKSFMVSWKKIPHLFLPKNFYCPEVNSTAY 300 ++T+ + DPT T S M S K + LF + +C ++ Y Sbjct: 295 VRTELEHDPTDIITMSSMTSEKLLDFLFQNEPIFCSNISKYRY 337 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,810,291 Number of Sequences: 27780 Number of extensions: 137982 Number of successful extensions: 250 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 248 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 250 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 767282256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -