BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_F04 (443 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g45800.1 68416.m04957 hypothetical protein 33 0.066 At2g26410.1 68415.m03169 calmodulin-binding family protein simil... 30 0.81 At3g60790.1 68416.m06800 F-box protein-related contains weak hit... 27 7.5 >At3g45800.1 68416.m04957 hypothetical protein Length = 563 Score = 33.5 bits (73), Expect = 0.066 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = +3 Query: 27 CLKLNFLNYKYYRHENDLCIFNCCLSGYNYETTVFEFFIVFHFEK 161 C + FL KYY+ + C N L+ Y Y + ++FH K Sbjct: 42 CNRYIFLTLKYYKTNKENCYINEILASYKYPFNLITDSLIFHSSK 86 >At2g26410.1 68415.m03169 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 516 Score = 29.9 bits (64), Expect = 0.81 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +1 Query: 154 LKNTKALKTKEDADPTKQKTKSFMVSWKKIPHLFLPK 264 L NT+A+K+K + T K + KK P + LPK Sbjct: 442 LANTEAVKSKVNVGTTSMPKKEVVADKKKPPQMVLPK 478 >At3g60790.1 68416.m06800 F-box protein-related contains weak hit to Pfam PF00646: F-box domain Length = 488 Score = 26.6 bits (56), Expect = 7.5 Identities = 17/51 (33%), Positives = 25/51 (49%) Frame = +1 Query: 157 KNTKALKTKEDADPTKQKTKSFMVSWKKIPHLFLPKNFYCPEVNSTAYTNK 309 K L TK DA T +K ++ WK+IPHL + N T+Y ++ Sbjct: 62 KILSTLSTK-DAVITSTLSKRWVDQWKRIPHLCVDMR-NIMRTNPTSYVHE 110 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,049,247 Number of Sequences: 28952 Number of extensions: 116958 Number of successful extensions: 245 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 244 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 245 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 712739520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -