BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_E23 (640 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18330| Best HMM Match : rve (HMM E-Value=1.2e-16) 30 1.8 SB_27746| Best HMM Match : MAM (HMM E-Value=1.4013e-45) 27 9.7 >SB_18330| Best HMM Match : rve (HMM E-Value=1.2e-16) Length = 997 Score = 29.9 bits (64), Expect = 1.8 Identities = 14/27 (51%), Positives = 19/27 (70%) Frame = +2 Query: 107 MYSVLTRGNAILTYTLSVLACLTFLLF 187 M + L+R N + +TL+VLA LTFL F Sbjct: 50 MNTFLSRLNTVFAFTLTVLAGLTFLCF 76 >SB_27746| Best HMM Match : MAM (HMM E-Value=1.4013e-45) Length = 622 Score = 27.5 bits (58), Expect = 9.7 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = +1 Query: 163 SMSYFLAVFYQPCTVDYRTGAQMNTVKVXVKNVPDY 270 SM +++ FYQ V+Y+T +M T V +V D+ Sbjct: 577 SMCFWIKSFYQGFYVEYKTKTEMATTLEFVVDVLDW 612 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,127,415 Number of Sequences: 59808 Number of extensions: 308596 Number of successful extensions: 686 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 619 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 686 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1608851125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -