BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_E16 (480 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U53148-5|AAB37076.1| 130|Caenorhabditis elegans Ribosomal prote... 85 3e-17 Z48045-11|CAM33500.1| 887|Caenorhabditis elegans Hypothetical p... 27 7.0 Z48045-10|CAA88101.2| 849|Caenorhabditis elegans Hypothetical p... 27 7.0 U41541-3|AAK18894.1| 7829|Caenorhabditis elegans Hypothetical pr... 27 7.0 Z75710-3|CAB00026.1| 275|Caenorhabditis elegans Hypothetical pr... 27 9.3 AF016682-8|AAO38605.1| 422|Caenorhabditis elegans Hypothetical ... 27 9.3 AF000194-3|AAK39379.1| 191|Caenorhabditis elegans Hypothetical ... 27 9.3 >U53148-5|AAB37076.1| 130|Caenorhabditis elegans Ribosomal protein, small subunitprotein 30 protein. Length = 130 Score = 84.6 bits (200), Expect = 3e-17 Identities = 40/63 (63%), Positives = 46/63 (73%) Frame = +3 Query: 237 LLGGKVHGSLARAGKVKGQTPKVEXXXXXXXXTGRAKRXIQYNRRFVNVVQTFGRRRGPN 416 LLGGKVHGSLARAGKV+ QTPKV+ GRA R +QY RR+VNV G++RGPN Sbjct: 68 LLGGKVHGSLARAGKVRAQTPKVDKQDKKKKKRGRAFRRVQYTRRYVNVASGPGKKRGPN 127 Query: 417 SNS 425 SNS Sbjct: 128 SNS 130 >Z48045-11|CAM33500.1| 887|Caenorhabditis elegans Hypothetical protein C41C4.5b protein. Length = 887 Score = 27.1 bits (57), Expect = 7.0 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +2 Query: 335 WPC*AXNSVQQKICQRCAD 391 WPC +S ++K+C C D Sbjct: 269 WPCFPYSSWKEKLCSECVD 287 >Z48045-10|CAA88101.2| 849|Caenorhabditis elegans Hypothetical protein C41C4.5a protein. Length = 849 Score = 27.1 bits (57), Expect = 7.0 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +2 Query: 335 WPC*AXNSVQQKICQRCAD 391 WPC +S ++K+C C D Sbjct: 231 WPCFPYSSWKEKLCSECVD 249 >U41541-3|AAK18894.1| 7829|Caenorhabditis elegans Hypothetical protein C41A3.1 protein. Length = 7829 Score = 27.1 bits (57), Expect = 7.0 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = +1 Query: 28 FTICSCISEGNRHTSWTSMARS 93 F I C G HT WT RS Sbjct: 4931 FIIICCFENGTSHTEWTGTLRS 4952 >Z75710-3|CAB00026.1| 275|Caenorhabditis elegans Hypothetical protein D1081.5 protein. Length = 275 Score = 26.6 bits (56), Expect = 9.3 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +1 Query: 322 RXRRLAVLSVXFSTTEDLSTLCRPSDV 402 + RR +VL+V DLS+LC PS + Sbjct: 176 KTRRHSVLNVTTDFDVDLSSLCEPSQI 202 >AF016682-8|AAO38605.1| 422|Caenorhabditis elegans Hypothetical protein T07D3.9b protein. Length = 422 Score = 26.6 bits (56), Expect = 9.3 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = -1 Query: 147 LHRQLQQEYECVP*SDQWTPGH*R-PGRVSIAL*YATAYCKI 25 LH ++E EC P + H + PGR S A YA C+I Sbjct: 375 LHDGKRRESECAPCGSKALCAHHKLPGRTSAAEQYAEKNCEI 416 >AF000194-3|AAK39379.1| 191|Caenorhabditis elegans Hypothetical protein ZC328.5 protein. Length = 191 Score = 26.6 bits (56), Expect = 9.3 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = -3 Query: 334 VFXFFFCCFSTLGVCPLTLPARAKDPCTLPPSNGTV 227 +F F + + + P RAK P T PPS TV Sbjct: 5 IFTFLALLAAAINIGEGAKPCRAKRPTTEPPSTTTV 40 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,710,623 Number of Sequences: 27780 Number of extensions: 160809 Number of successful extensions: 349 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 337 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 349 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 882200194 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -