BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_E11 (381 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45836| Best HMM Match : EGF (HMM E-Value=6.7e-21) 28 2.2 SB_55589| Best HMM Match : adh_short (HMM E-Value=0.14) 27 5.2 SB_18476| Best HMM Match : EF1_GNE (HMM E-Value=3.4) 27 5.2 >SB_45836| Best HMM Match : EGF (HMM E-Value=6.7e-21) Length = 1332 Score = 28.3 bits (60), Expect = 2.2 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = +2 Query: 107 RLWRSEHFSLLGGKKGRFPHRTELKARIGEXSXXT*CSGKIIL 235 +LW F + G KKG FP+ ++ R+ + CS +IL Sbjct: 1080 QLWLLSRFKINGTKKGCFPYNKQIFWRLNKVKKKE-CSHTVIL 1121 >SB_55589| Best HMM Match : adh_short (HMM E-Value=0.14) Length = 337 Score = 27.1 bits (57), Expect = 5.2 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = -1 Query: 201 LXSPIRALSSVRWGNLPFLPPSKEKCSDRHNRH 103 L + A+ V W +L FLPP++ + D HN++ Sbjct: 130 LAGAVIAVLFVAWLSLKFLPPTR-RVGDYHNKY 161 >SB_18476| Best HMM Match : EF1_GNE (HMM E-Value=3.4) Length = 277 Score = 27.1 bits (57), Expect = 5.2 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +1 Query: 28 HFAMTKNSNSQGSNTSAANAIALGAMT 108 H TK SNS S T+A NA+ A+T Sbjct: 249 HRDTTKGSNSSLSKTTALNAVKFAAIT 275 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,419,339 Number of Sequences: 59808 Number of extensions: 159883 Number of successful extensions: 344 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 332 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 344 length of database: 16,821,457 effective HSP length: 74 effective length of database: 12,395,665 effective search space used: 644574580 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -