BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_E09 (617 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 24 4.5 AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. 24 4.5 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 24 4.5 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 23.8 bits (49), Expect = 4.5 Identities = 14/44 (31%), Positives = 19/44 (43%) Frame = -1 Query: 272 GLSSYELRNPCSVFYQHP*WSLD*ERRFLRNSPAPRTRHPTFVS 141 G+ L NP ++ Y P LD + LR S HP + S Sbjct: 375 GMPPANLFNPAALAYHDPAIYLDPRYQMLRASHHSAAGHPLYPS 418 >AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. Length = 615 Score = 23.8 bits (49), Expect = 4.5 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +2 Query: 242 TDYEVRMRTNLPVFKVKDSSVRRRYXDFE 328 +D +V+ R LP+ K S R Y DF+ Sbjct: 512 SDAKVKGRPILPLLKTVQSYKREHYHDFK 540 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 23.8 bits (49), Expect = 4.5 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +1 Query: 553 RQELRARQDQEHITVHAAPSP 615 RQ R +D + IT+H +P P Sbjct: 1201 RQRQRRARDSQAITIHFSPLP 1221 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 536,149 Number of Sequences: 2352 Number of extensions: 9482 Number of successful extensions: 9 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 60553008 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -