BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_E05 (413 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A2DI70 Cluster: Putative uncharacterized protein; n=1; ... 33 3.1 UniRef50_A5KIQ4 Cluster: Putative uncharacterized protein; n=2; ... 32 5.3 UniRef50_Q9L6G6 Cluster: Primase-helicase; n=5; Lactobacillus de... 31 7.1 UniRef50_A7A2K1 Cluster: Putative uncharacterized protein; n=1; ... 31 7.1 >UniRef50_A2DI70 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 289 Score = 32.7 bits (71), Expect = 3.1 Identities = 23/89 (25%), Positives = 35/89 (39%), Gaps = 3/89 (3%) Frame = -2 Query: 370 DPAQGSSYSGSGFNAHXICSHHTRVR**FCGPXFS*GNVIGIGP---LFTLRILASTXGS 200 D G YS +GF + C H + G S G V+ + P F + + Sbjct: 2 DTFAGYPYSFAGFIDYSNCYHPVAIPWLLVGIGVSIGTVVSVIPQLQKFVQKRSNYGMNT 61 Query: 199 LRHCCTIYSSSLHLIYYFCMH*RKFTTMV 113 L C Y ++ + YFC+H F +V Sbjct: 62 LTICLISYGQIINFVNYFCLHSADFVGIV 90 >UniRef50_A5KIQ4 Cluster: Putative uncharacterized protein; n=2; Ruminococcus|Rep: Putative uncharacterized protein - Ruminococcus torques ATCC 27756 Length = 288 Score = 31.9 bits (69), Expect = 5.3 Identities = 11/17 (64%), Positives = 15/17 (88%) Frame = +2 Query: 101 CSVFYHCGKFSSVHTEI 151 C++F+H GK SSVH+EI Sbjct: 148 CALFFHAGKLSSVHSEI 164 >UniRef50_Q9L6G6 Cluster: Primase-helicase; n=5; Lactobacillus delbrueckii|Rep: Primase-helicase - Lactobacillus delbrueckii subsp. bulgaricus Length = 688 Score = 31.5 bits (68), Expect = 7.1 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = -3 Query: 144 VCTDENLPQW*NTEHCGFHYFRILVLIMQMPVQMP 40 +C D N PQ+ + CG Y R++V ++ M Q P Sbjct: 47 MCVDRNHPQYVHCFSCGVSYDRLIVGLLLMTAQRP 81 >UniRef50_A7A2K1 Cluster: Putative uncharacterized protein; n=1; Bifidobacterium adolescentis L2-32|Rep: Putative uncharacterized protein - Bifidobacterium adolescentis L2-32 Length = 299 Score = 31.5 bits (68), Expect = 7.1 Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 2/44 (4%) Frame = +2 Query: 113 YHCGKFSSVHTEIIDQ--MQAGGIDSAAMSETPXSGSEDSECEQ 238 Y CG+F+ +HTE +D+ ++ G SAA+S + G+ E Q Sbjct: 179 YPCGRFTFLHTETLDRGVLRTLGTLSAALSASSNRGTRRPELAQ 222 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 330,213,265 Number of Sequences: 1657284 Number of extensions: 5030525 Number of successful extensions: 10882 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10613 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10872 length of database: 575,637,011 effective HSP length: 92 effective length of database: 423,166,883 effective search space used: 19042509735 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -