BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_E05 (413 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC6F6.02c |pof5||F-box protein Pof5|Schizosaccharomyces pombe|... 28 0.50 SPAC56F8.15 |||dubious|Schizosaccharomyces pombe|chr 1|||Manual 26 2.7 >SPAC6F6.02c |pof5||F-box protein Pof5|Schizosaccharomyces pombe|chr 1|||Manual Length = 348 Score = 28.3 bits (60), Expect = 0.50 Identities = 19/59 (32%), Positives = 28/59 (47%), Gaps = 4/59 (6%) Frame = -2 Query: 205 GSLRHCCTIYSSSLHLIYYF----CMH*RKFTTMVKHRTLRFSLLSNISINHADARADA 41 G LR C + Y LH IYYF + KF + + R L+ +IS+N+ + A Sbjct: 29 GLLRICRSSYVGGLHAIYYFPKLNPRNYHKFVDTISRKPTR-KLVHHISLNNVSYASKA 86 >SPAC56F8.15 |||dubious|Schizosaccharomyces pombe|chr 1|||Manual Length = 176 Score = 25.8 bits (54), Expect = 2.7 Identities = 13/39 (33%), Positives = 20/39 (51%), Gaps = 4/39 (10%) Frame = -2 Query: 241 PLFTLRILASTXGSLRHC-CTIYSSSLHLIYYF---CMH 137 P +++ S L H C+IYS +LH ++F C H Sbjct: 34 PFYSILCFLSFFALLLHLPCSIYSHTLHFFHHFTIACYH 72 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,327,918 Number of Sequences: 5004 Number of extensions: 20082 Number of successful extensions: 34 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 34 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 144287194 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -