BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_E02 (603 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC32A11.02c |||conserved fungal protein|Schizosaccharomyces po... 31 0.13 SPAC32A11.03c |phx1||homeobox transcription factor Phx1|Schizosa... 25 6.4 >SPAC32A11.02c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 851 Score = 31.1 bits (67), Expect = 0.13 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 2/54 (3%) Frame = +1 Query: 133 RNSDSIRX--YNNILLNTYNVTDLHASNVFF*LKLCNFYLVRDDGGNNFVSLKV 288 RN++ +R Y NI N+ ++H SN+ LK N+Y+ R G F L V Sbjct: 468 RNNNFVRFSPYANITSFRENMINVHLSNIQCDLKDVNYYIKRKQGFPTFTDLGV 521 >SPAC32A11.03c |phx1||homeobox transcription factor Phx1|Schizosaccharomyces pombe|chr 1|||Manual Length = 942 Score = 25.4 bits (53), Expect = 6.4 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +3 Query: 87 YYYFVCSLLLISRW 128 +YYF C+LL+I W Sbjct: 436 FYYFSCTLLVIGLW 449 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,232,543 Number of Sequences: 5004 Number of extensions: 40285 Number of successful extensions: 75 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 73 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 75 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 264253462 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -