BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_E02 (603 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1668 + 38998348-38998434,38999234-38999300,38999377-389994... 37 0.014 03_05_0833 - 28045442-28045881,28045961-28046063,28046172-280462... 35 0.043 04_04_0496 + 25631832-25631972,25632094-25632160,25634993-256350... 35 0.057 09_04_0703 - 19614057-19614264,19615305-19615407,19615880-196159... 34 0.100 09_04_0586 - 18736643-18736914,18737085-18737187,18737279-187379... 33 0.17 05_04_0038 + 17403620-17403769,17403975-17404038,17404807-174048... 33 0.17 11_01_0536 + 4243306-4243449,4243790-4243856,4243996-4244054,424... 33 0.23 05_04_0036 + 17386160-17386318,17386588-17386651,17387089-173871... 33 0.23 12_02_0067 + 13144002-13144203,13144471-13144529,13144638-131447... 31 0.53 10_05_0036 + 8443957-8444112,8446063-8446129,8446685-8446743,844... 31 0.70 07_03_1537 + 27562097-27562340,27562436-27562494,27562605-275626... 31 0.70 01_07_0064 + 40834649-40834786,40834934-40834997,40835333-408353... 31 0.70 03_05_0832 - 28037047-28037315,28037428-28037530,28037664-280376... 31 0.93 08_02_1201 - 25243516-25243681,25243784-25243892,25244046-252441... 30 1.2 01_05_0061 + 17752382-17752652,17753521-17753579,17753919-17753936 29 2.1 06_02_0148 - 12280794-12280962,12281102-12281210,12281283-122813... 29 2.8 04_04_0223 - 23723055-23723223,23723316-23723424,23723588-237236... 29 2.8 04_04_0222 - 23717106-23717162,23717527-23717670 29 2.8 04_04_0217 - 23693124-23693535,23693965-23694052,23694428-236945... 29 3.7 01_06_1111 - 34599014-34599215,34599378-34599497,34599654-345997... 29 3.7 01_06_1110 - 34582267-34582468,34582732-34582819,34589337-345894... 29 3.7 05_04_0043 + 17450999-17451181,17451353-17451416,17451642-174517... 28 6.5 09_05_0013 + 20067115-20067183,20067585-20067691,20067905-200680... 27 8.7 08_02_1460 + 27295201-27295269,27295968-27296074,27296252-272963... 27 8.7 04_04_0220 - 23708174-23708316,23708569-23708851 27 8.7 >01_06_1668 + 38998348-38998434,38999234-38999300,38999377-38999435, 38999636-38999711,38999856-38999930,39000007-39000094, 39000261-39000486,39000689-39000804,39001172-39001383, 39001882-39001916,39002005-39002107,39002645-39002753, 39002838-39003036 Length = 483 Score = 36.7 bits (81), Expect = 0.014 Identities = 15/25 (60%), Positives = 19/25 (76%) Frame = +3 Query: 276 FPKGFKFGVATASFQVEGAWNVSGK 350 FP GF FGVAT+++Q+EGA GK Sbjct: 15 FPDGFVFGVATSAYQIEGARREGGK 39 >03_05_0833 - 28045442-28045881,28045961-28046063,28046172-28046203, 28046299-28046516,28046606-28046721,28047757-28048000, 28048423-28048510,28048596-28048667,28048758-28048869, 28049047-28049115,28049627-28049685,28050067-28050325 Length = 603 Score = 35.1 bits (77), Expect = 0.043 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +3 Query: 276 FPKGFKFGVATASFQVEG 329 FPKGF FG AT++FQVEG Sbjct: 50 FPKGFVFGTATSAFQVEG 67 >04_04_0496 + 25631832-25631972,25632094-25632160,25634993-25635054, 25636173-25636248,25636355-25636429,25637768-25637825, 25637955-25638207,25639030-25639037,25639159-25639411, 25639503-25639605,25639750-25639852,25639947-25640160 Length = 470 Score = 34.7 bits (76), Expect = 0.057 Identities = 15/28 (53%), Positives = 21/28 (75%) Frame = +3 Query: 252 GRRREQLCFPKGFKFGVATASFQVEGAW 335 G RR+ FP GF FG AT+++Q+EGA+ Sbjct: 27 GLRRDD--FPPGFLFGAATSAYQIEGAY 52 >09_04_0703 - 19614057-19614264,19615305-19615407,19615880-19615973, 19616216-19616229,19616384-19616595,19617653-19617940, 19618275-19618362,19618444-19618515,19618597-19618672, 19618755-19618813,19618953-19619016,19619253-19619402 Length = 475 Score = 33.9 bits (74), Expect = 0.100 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 3/55 (5%) Frame = +3 Query: 195 LARFKRILLIEIV*LLFSAGRRREQLC---FPKGFKFGVATASFQVEGAWNVSGK 350 LA + ++ + LL + R L FP+GF FG +++FQVEGA G+ Sbjct: 6 LALVSSLFIVVVFLLLGAVAREASALTRHDFPEGFVFGAGSSAFQVEGAAAEDGR 60 >09_04_0586 - 18736643-18736914,18737085-18737187,18737279-18737900, 18738376-18738463,18738537-18738614,18738741-18738816, 18738912-18738970,18739061-18739127,18739268-18739405 Length = 500 Score = 33.1 bits (72), Expect = 0.17 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 2/50 (4%) Frame = +3 Query: 207 KRILLIEIV*LLFSAG--RRREQLCFPKGFKFGVATASFQVEGAWNVSGK 350 +R+L + LF G + + FPK F FG +A++Q EGA+ GK Sbjct: 7 RRLLFTLFLGALFCNGVYAKFTRYSFPKDFIFGTGSAAYQYEGAYKEGGK 56 >05_04_0038 + 17403620-17403769,17403975-17404038,17404807-17404865, 17404981-17405056,17405196-17405267,17405411-17405498, 17405617-17405872,17405972-17406087,17406757-17406977, 17407074-17407102,17407192-17407291,17407405-17407492, 17407640-17407874 Length = 517 Score = 33.1 bits (72), Expect = 0.17 Identities = 21/57 (36%), Positives = 30/57 (52%) Frame = +3 Query: 180 IQCYRLARFKRILLIEIV*LLFSAGRRREQLCFPKGFKFGVATASFQVEGAWNVSGK 350 + + L F LL+ ++ + S RRE FP GF FG TA++Q EGA G+ Sbjct: 6 LHLHLLLFFSAWLLLLLLQGVSSLQFRRED--FPDGFAFGAGTAAYQYEGAAAEDGR 60 >11_01_0536 + 4243306-4243449,4243790-4243856,4243996-4244054, 4244157-4244314,4244742-4244990,4245079-4245451, 4245580-4245702 Length = 390 Score = 32.7 bits (71), Expect = 0.23 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +3 Query: 276 FPKGFKFGVATASFQVEGAWNVSGK 350 FPK F FG +A++Q EGA+ GK Sbjct: 34 FPKDFIFGTGSAAYQYEGAYKEGGK 58 >05_04_0036 + 17386160-17386318,17386588-17386651,17387089-17387147, 17387268-17387343,17387521-17387592,17387786-17387873, 17387992-17388250,17388446-17388561,17388876-17389096, 17389196-17389224,17389285-17389420,17389567-17389651, 17389735-17389963 Length = 530 Score = 32.7 bits (71), Expect = 0.23 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +3 Query: 276 FPKGFKFGVATASFQVEGAWNVSGK 350 FP GF FG TA+FQ EGA G+ Sbjct: 39 FPDGFTFGAGTAAFQYEGAAAEDGR 63 >12_02_0067 + 13144002-13144203,13144471-13144529,13144638-13144713, 13144802-13144873,13144969-13145056,13145365-13145601, 13145705-13145910,13145946-13146122,13146220-13146251, 13146330-13146432,13146547-13146815,13148029-13148175, 13148272-13148412,13148509-13148595,13148841-13148931, 13149093-13149192,13149292-13149352,13149442-13149663, 13149756-13149872,13149972-13150061,13150168-13150344 Length = 917 Score = 31.5 bits (68), Expect = 0.53 Identities = 18/43 (41%), Positives = 26/43 (60%), Gaps = 4/43 (9%) Frame = +3 Query: 213 ILLIEIV*LLFSAGRRRE----QLCFPKGFKFGVATASFQVEG 329 +LLI IV + S G + + FP GF FG A++++QVEG Sbjct: 6 LLLIAIVVVSLSHGNGEQTDLTRETFPAGFVFGTASSAYQVEG 48 >10_05_0036 + 8443957-8444112,8446063-8446129,8446685-8446743, 8446855-8446930,8447118-8447189,8447326-8447413, 8447489-8447744,8447934-8448049,8448247-8448470, 8448685-8448716,8448882-8449018,8449200-8449289, 8449383-8449557 Length = 515 Score = 31.1 bits (67), Expect = 0.70 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +3 Query: 276 FPKGFKFGVATASFQVEGAWNVSGK 350 FP GF FG A++++Q EGA G+ Sbjct: 38 FPNGFVFGTASSAYQYEGAVKEDGR 62 >07_03_1537 + 27562097-27562340,27562436-27562494,27562605-27562680, 27562776-27562847,27562934-27563021,27563118-27563361, 27563490-27563605,27563783-27564000,27564113-27564144, 27564262-27564364,27564471-27564751 Length = 510 Score = 31.1 bits (67), Expect = 0.70 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +3 Query: 276 FPKGFKFGVATASFQVEGAWNVSGK 350 FP+GF FG A +++QVEG G+ Sbjct: 45 FPEGFVFGTAASAYQVEGMAKQGGR 69 >01_07_0064 + 40834649-40834786,40834934-40834997,40835333-40835391, 40835602-40835677,40835775-40835846,40837641-40837728, 40838239-40838497,40838766-40839000,40839447-40839470, 40839910-40839997,40840110-40840300,40841082-40841322, 40841803-40842556 Length = 762 Score = 31.1 bits (67), Expect = 0.70 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +3 Query: 276 FPKGFKFGVATASFQVEGAWNVSGK 350 FP+ F FG AT+S+Q EG ++ G+ Sbjct: 32 FPEDFVFGSATSSYQYEGGFDEDGR 56 >03_05_0832 - 28037047-28037315,28037428-28037530,28037664-28037695, 28037788-28038005,28038145-28038260,28038514-28038757, 28039129-28039216,28039513-28039588,28040126-28040164, 28040347-28040405,28041292-28041529 Length = 493 Score = 30.7 bits (66), Expect = 0.93 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +3 Query: 276 FPKGFKFGVATASFQVEG 329 FPK F FG AT+++QVEG Sbjct: 43 FPKRFVFGTATSAYQVEG 60 >08_02_1201 - 25243516-25243681,25243784-25243892,25244046-25244148, 25244273-25244304,25244405-25244625,25244948-25245063, 25245149-25245404,25245916-25246003,25246133-25246210, 25246541-25246659,25246893-25246942,25247117-25247245 Length = 488 Score = 30.3 bits (65), Expect = 1.2 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +3 Query: 276 FPKGFKFGVATASFQVEGAWNVSGK 350 FP+ F FG +A++Q EGA N G+ Sbjct: 29 FPEDFIFGTGSAAYQYEGAVNEGGR 53 >01_05_0061 + 17752382-17752652,17753521-17753579,17753919-17753936 Length = 115 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +3 Query: 276 FPKGFKFGVATASFQVEG 329 FP GF FG A +++QVEG Sbjct: 54 FPAGFVFGTAASAYQVEG 71 >06_02_0148 - 12280794-12280962,12281102-12281210,12281283-12281385, 12281587-12281618,12281709-12281926,12282035-12282150, 12282428-12282683,12282912-12282999,12283393-12283468, 12283562-12283620,12285236-12285305,12285399-12285539 Length = 478 Score = 29.1 bits (62), Expect = 2.8 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = +3 Query: 258 RREQLCFPKGFKFGVATASFQVEGAWNVSGK 350 RR Q FP+ F FG A++++Q EGA G+ Sbjct: 29 RRSQ--FPEDFFFGTASSAYQYEGAVREGGR 57 >04_04_0223 - 23723055-23723223,23723316-23723424,23723588-23723690, 23723781-23723812,23724024-23724241,23724322-23724437, 23725055-23725310,23725719-23725806,23725928-23726005, 23726199-23726274,23726525-23726583,23727715-23728066 Length = 551 Score = 29.1 bits (62), Expect = 2.8 Identities = 11/17 (64%), Positives = 15/17 (88%) Frame = +3 Query: 276 FPKGFKFGVATASFQVE 326 FPKGF FG A++S+QV+ Sbjct: 39 FPKGFIFGTASSSYQVK 55 >04_04_0222 - 23717106-23717162,23717527-23717670 Length = 66 Score = 29.1 bits (62), Expect = 2.8 Identities = 12/23 (52%), Positives = 18/23 (78%) Frame = +3 Query: 276 FPKGFKFGVATASFQVEGAWNVS 344 FPKGF FG +++S+Q+ WN+S Sbjct: 34 FPKGFIFGTSSSSYQL-FRWNMS 55 >04_04_0217 - 23693124-23693535,23693965-23694052,23694428-23694503, 23694729-23694787,23694853-23694934,23695533-23696577, 23696700-23696998 Length = 686 Score = 28.7 bits (61), Expect = 3.7 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +3 Query: 276 FPKGFKFGVATASFQV 323 FPKGF FG ++AS+QV Sbjct: 34 FPKGFIFGTSSASYQV 49 >01_06_1111 - 34599014-34599215,34599378-34599497,34599654-34599760, 34600452-34600480,34600768-34600982,34601215-34601330, 34601960-34602218,34602342-34602429,34602932-34603003, 34603080-34603155,34603579-34603637,34603937-34604000, 34604104-34604232 Length = 511 Score = 28.7 bits (61), Expect = 3.7 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +3 Query: 276 FPKGFKFGVATASFQVEGAWNVSGK 350 FP F FG AT+++Q EGA G+ Sbjct: 29 FPADFVFGAATSAYQYEGAAAEDGR 53 >01_06_1110 - 34582267-34582468,34582732-34582819,34589337-34589439, 34589886-34589914,34590114-34590144,34590621-34590822, 34591424-34591539,34591784-34592006,34592151-34592238, 34592336-34592407,34592485-34592560,34593822-34593880, 34595341-34595404,34595487-34595618 Length = 494 Score = 28.7 bits (61), Expect = 3.7 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +3 Query: 276 FPKGFKFGVATASFQVEGAWNVSGK 350 FP+ F FG AT+++Q +GA G+ Sbjct: 30 FPRDFVFGAATSAYQYDGAAAEDGR 54 >05_04_0043 + 17450999-17451181,17451353-17451416,17451642-17451700, 17452331-17452406,17452469-17452597,17453524-17453611, 17453711-17453966,17454308-17454423,17454569-17454789, 17454977-17455005,17455167-17455273,17455778-17456015 Length = 521 Score = 27.9 bits (59), Expect = 6.5 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +3 Query: 276 FPKGFKFGVATASFQVEGAWNVSGK 350 FP F FG T+++Q EGA + G+ Sbjct: 47 FPGEFVFGAGTSAYQYEGATDEDGR 71 >09_05_0013 + 20067115-20067183,20067585-20067691,20067905-20068037, 20068163-20068306,20068415-20068573,20068710-20068783, 20068907-20068982,20069100-20069155,20069346-20069433, 20069508-20069648,20069737-20069886,20070165-20070398 Length = 476 Score = 27.5 bits (58), Expect = 8.7 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -2 Query: 320 LERRCGYSEFETFRETKLFPPSS 252 +E R G +FET ++T L PP + Sbjct: 412 MEHRYGAKDFETCKDTSLLPPGT 434 >08_02_1460 + 27295201-27295269,27295968-27296074,27296252-27296384, 27296621-27296714,27296828-27297030,27297167-27297240, 27297331-27297406,27297530-27297585,27297939-27298026, 27298115-27298255,27298338-27298487,27299015-27299221 Length = 465 Score = 27.5 bits (58), Expect = 8.7 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -2 Query: 320 LERRCGYSEFETFRETKLFPPSS 252 +E R G +FET ++T L PP + Sbjct: 410 MEHRYGAKDFETSKDTSLLPPGT 432 >04_04_0220 - 23708174-23708316,23708569-23708851 Length = 141 Score = 27.5 bits (58), Expect = 8.7 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = +3 Query: 276 FPKGFKFGVATASFQV 323 FPKGF FG +++S+QV Sbjct: 39 FPKGFIFGTSSSSYQV 54 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,836,344 Number of Sequences: 37544 Number of extensions: 239543 Number of successful extensions: 437 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 434 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 437 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1431112012 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -