BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_D24 (497 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U53148-5|AAB37076.1| 130|Caenorhabditis elegans Ribosomal prote... 87 7e-18 U80452-10|AAB37853.1| 214|Caenorhabditis elegans Hypothetical p... 29 2.5 >U53148-5|AAB37076.1| 130|Caenorhabditis elegans Ribosomal protein, small subunitprotein 30 protein. Length = 130 Score = 87.0 bits (206), Expect = 7e-18 Identities = 41/63 (65%), Positives = 47/63 (74%) Frame = +3 Query: 249 LLGGKVHGSLARAGKVKGQTPKVEXXXXXXXXTGRAKRRIQYNRRFVNVVQTFGRRRGPN 428 LLGGKVHGSLARAGKV+ QTPKV+ GRA RR+QY RR+VNV G++RGPN Sbjct: 68 LLGGKVHGSLARAGKVRAQTPKVDKQDKKKKKRGRAFRRVQYTRRYVNVASGPGKKRGPN 127 Query: 429 SNS 437 SNS Sbjct: 128 SNS 130 >U80452-10|AAB37853.1| 214|Caenorhabditis elegans Hypothetical protein C16C8.11 protein. Length = 214 Score = 28.7 bits (61), Expect = 2.5 Identities = 16/54 (29%), Positives = 25/54 (46%) Frame = +3 Query: 33 KILQLCSCISEGNRHTSWTSTGQESIGQIKERIRTLAAVGDEDLTLSLCGAPLH 194 K++ LC +S R S + ES+ Q+K +I + L L G PL+ Sbjct: 140 KVVDLCIAVSMPGRLFSIGANKMESVEQLKMKIECQTGIPRTKFWLRLHGKPLY 193 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,481,398 Number of Sequences: 27780 Number of extensions: 190688 Number of successful extensions: 416 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 405 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 416 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 945973702 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -