BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_D21 (620 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropi... 26 0.26 DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 23 3.2 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 21 7.3 AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phospha... 21 7.3 >AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropin releasing hormone-binding protein protein. Length = 332 Score = 26.2 bits (55), Expect = 0.26 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = +1 Query: 13 FIFDLPQRESXNQ*NLRNIGVQFSILTDCVF*T 111 F D ++++ N NL N V+F ++TDC+F T Sbjct: 44 FSKDFYRQDTKN--NLLNAYVRFKLVTDCIFVT 74 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 22.6 bits (46), Expect = 3.2 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = +2 Query: 176 IILNIYLFYSVTC*FCGAMNKYAVLFNLKKIL 271 +I+N+ L V C C + + L+ LK L Sbjct: 13 VIINVLLHGQVICFVCKDITSTSALYRLKLYL 44 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 21.4 bits (43), Expect = 7.3 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -2 Query: 331 FSFRYIFSFCVYNCG 287 F++RY FSF +Y G Sbjct: 223 FTYRYGFSFLLYVSG 237 >AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phosphate dehydrogenase protein. Length = 363 Score = 21.4 bits (43), Expect = 7.3 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +2 Query: 287 TTIINAEGKNVPKRKNFENRITL 355 +TI G N NFE+R+T+ Sbjct: 17 STIAKIIGINAANFSNFEDRVTM 39 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 128,368 Number of Sequences: 438 Number of extensions: 2208 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18460203 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -