BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_D11 (656 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 22 5.9 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 21 7.8 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 21 7.8 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 21.8 bits (44), Expect = 5.9 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -3 Query: 285 SFPRFRAPGFV 253 S+PR RAP F+ Sbjct: 110 SYPRMRAPSFI 120 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 21.4 bits (43), Expect = 7.8 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = +3 Query: 102 LATKRTKTKMFKNTFQSGFLSILYSIGSKPL 194 +A K+ N F S LY++G +PL Sbjct: 132 IAPNNGAVKVLANEFLSILPIFLYALGEQPL 162 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 21.4 bits (43), Expect = 7.8 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = +3 Query: 102 LATKRTKTKMFKNTFQSGFLSILYSIGSKPL 194 +A K+ N F S LY++G +PL Sbjct: 170 IAPNNGAVKVLANEFLSILPIFLYALGEQPL 200 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,979 Number of Sequences: 438 Number of extensions: 3668 Number of successful extensions: 11 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19734030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -