BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_D08 (650 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_36536| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_47442| Best HMM Match : Linker_histone (HMM E-Value=1.4e-36) 28 5.7 >SB_36536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1258 Score = 29.9 bits (64), Expect = 1.9 Identities = 15/46 (32%), Positives = 27/46 (58%) Frame = +1 Query: 325 AKITLNADSGPSRWSNITITTWSLNLFDGHFSTRKDYIHSLSLHYY 462 A+I LNA + S+I+++ SL +FD T K++ ++ +H Y Sbjct: 582 AQILLNALQNKNELSSISLSDLSLLIFDECHHTNKNHSYNKIMHQY 627 >SB_47442| Best HMM Match : Linker_histone (HMM E-Value=1.4e-36) Length = 650 Score = 28.3 bits (60), Expect = 5.7 Identities = 20/62 (32%), Positives = 25/62 (40%) Frame = -1 Query: 212 CKVAGDGRFIDLDRN***HRFSSRSSEICL*HKNTKATTFETALKRAFVANYNEPCSNAT 33 C + G F+D N HRFSSR+ KNT T + + V CSN Sbjct: 152 CNLDGHEEFLDFVTNTHHHRFSSRALTRPFCFKNTTGTKPKFFCRPLNVPETKHICSNRV 211 Query: 32 TR 27 R Sbjct: 212 HR 213 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,110,183 Number of Sequences: 59808 Number of extensions: 338553 Number of successful extensions: 625 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 577 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 622 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1657237625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -