Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fe100P04_F_D08
         (650 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g43800.1 68414.m05046 acyl-[acyl-carrier-protein] desaturase,...    28   6.2  

>At1g43800.1 68414.m05046 acyl-[acyl-carrier-protein] desaturase,
           putative / stearoyl-ACP desaturase, putative similar to
           Acyl-[acyl-carrier protein] desaturase from Lupinus
           luteus GI:4704824, Asclepias syriaca GI:1762436, Ricinus
           communis SP|P22337; contains Pfam profile PF03405 Fatty
           acid desaturase
          Length = 391

 Score = 27.9 bits (59), Expect = 6.2
 Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 2/57 (3%)
 Frame = +2

Query: 107 SYSYVKGR--FLSFERKIDVIISCGLDQ*IDRRPQLYTVLSRWVE*STSRLRGHTTK 271
           +Y Y+ GR   L  ER +  +I  G+D   +  P L  V + + E +T    G+T +
Sbjct: 177 TYLYLSGRVDMLMVERTVQHLIGSGMDPGTENNPYLGFVYTSFQERATFVSHGNTAR 233


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,421,503
Number of Sequences: 28952
Number of extensions: 228970
Number of successful extensions: 490
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 480
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 490
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1354097952
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)