BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_C23 (353 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_07_0311 - 29139883-29140359,29140641-29140788,29140883-291409... 28 1.8 11_04_0048 + 12792270-12792276,12793453-12793697,12793866-12794741 28 2.4 02_01_0486 - 3495792-3496034,3496862-3496934,3497128-3497422,349... 26 7.4 >05_07_0311 - 29139883-29140359,29140641-29140788,29140883-29140959, 29141227-29141387,29141785-29142803,29142905-29142996, 29143117-29143256,29143397-29143574 Length = 763 Score = 28.3 bits (60), Expect = 1.8 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -2 Query: 181 RIIKLRSGGITVITKRCQGGWVLHPSRPKHE 89 ++I GG+ +KR Q WV+ KHE Sbjct: 112 KVIPASPGGVATESKRAQASWVVLDKELKHE 142 >11_04_0048 + 12792270-12792276,12793453-12793697,12793866-12794741 Length = 375 Score = 27.9 bits (59), Expect = 2.4 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +1 Query: 88 PHVWDAKDARPSRLDNA 138 PH+W A D+ P +DNA Sbjct: 147 PHIWSAIDSMPCSMDNA 163 >02_01_0486 - 3495792-3496034,3496862-3496934,3497128-3497422, 3497585-3497759,3498349-3498795,3499994-3500053 Length = 430 Score = 26.2 bits (55), Expect = 7.4 Identities = 9/18 (50%), Positives = 15/18 (83%) Frame = -1 Query: 188 LLKNHKITKRRDHSHYQA 135 LL+N ++T+RR+H H Q+ Sbjct: 385 LLRNQRLTQRRNHRHGQS 402 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,509,920 Number of Sequences: 37544 Number of extensions: 134222 Number of successful extensions: 217 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 217 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 217 length of database: 14,793,348 effective HSP length: 73 effective length of database: 12,052,636 effective search space used: 530315984 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -